LXL04_003322 | RubberDandelionOmics

Gene overview

LXL04_003322

Reference: OH-1004 Chr: Chr01 Coordinates: 74604155-74606527 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1008 bp · LXL04_003322|LXL04_003322|OH1004|cDNA

ATGGCGACCTGCACCACTTTTGAAGCTCTATCGTCTTTCGTCTGGAGAGCCAGAACCGAATCACTTCAAATGAAGCCAGATCAGAAAACGAAACTCCTCTTTTCCGTAGACGGACGCTTGAGATTCGAACCGCAGTTGCCGGAAGGATACTCTGGCAATGGAATCGTTCTAACTGGCTCTATATGCAAGACAGGAGAACAAGTCGGGAATCCTCTGTCGTTCGTGATGAAATTGATTCATGATACCGTGAAAATGATCTA...

CDS

Download CDS FASTA

1008 bp · LXL04_003322|LXL04_003322|OH1004|CDS

ATGGCGACCTGCACCACTTTTGAAGCTCTATCGTCTTTCGTCTGGAGAGCCAGAACCGAATCACTTCAAATGAAGCCAGATCAGAAAACGAAACTCCTCTTTTCCGTAGACGGACGCTTGAGATTCGAACCGCAGTTGCCGGAAGGATACTCTGGCAATGGAATCGTTCTAACTGGCTCTATATGCAAGACAGGAGAACAAGTCGGGAATCCTCTGTCGTTCGTGATGAAATTGATTCATGATACCGTGAAAATGATCTA...

Protein

Download Protein FASTA

335 aa · LXL04_003322|LXL04_003322|OH1004|PROTEIN

MATCTTFEALSSFVWRARTESLQMKPDQKTKLLFSVDGRLRFEPQLPEGYSGNGIVLTGSICKTGEQVGNPLSFVMKLIHDTVKMIYKQEGQYKNIFHQFPKKKNIGYSHVGLNYETAVEGHHWRIITSAMSHISVLHLVFNMSALWSLGVVEQLGHMGLGAAYYLHYSLLLLVLSGLLVLGSYHVLINRFKFEYFRRVTAVGYSCVVFGWMTILSVKQPSSKLNLFGFLSLPISFAPFESLIFTSIIVPQASFLGHLSG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003322`
TK1151 ID	TkA01G374450
OH-1004 ID	LXL04_003322
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	47.000
Protein coverage (%)	TK1151 79.286 / OH-1004 69.851 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003322

Location Chr01:74604155-74606527 (+)

Description Similar to RBL13: RHOMBOID-like protein 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g59520`	Probable rhomboid-type serine protease that catalyzes intramembrane proteolysis.	No verified direct reference in this release
`At5g41040`	Involved in the synthesis of aromatics of the suberin polymer.	Identification of an Arabidopsis feruloyl-coenzyme A transferase required for suberin synthesis.2009 · DOI: 10.1104/pp.109.144907 A hydroxycinnamoyltransferase responsible for synthesizing suberin aromatics in Arabidopsis.2009 · DOI: 10.1073/pnas.0905555106
`At5g63560`	Involved in the synthesis of alkyl hydroxycinnamates in root waxes.	Identification of an Arabidopsis fatty alcohol:caffeoyl-Coenzyme A acyltransferase required for the synthesis of alkyl hydroxycinnamates in root waxes.2012 · DOI: 10.1104/pp.112.201822

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003322 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006084 acetyl-CoA metabolic process Biological Process

GO:0006508 proteolysis Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0052325 cell wall pectin biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0090431 alkyl caffeate ester biosynthetic process Biological Process

GO:1901787 benzoyl-CoA metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ag:AAN09796

ag:AAU06226

ath:AT3G59520

ath:AT5G41040

ath:AT5G63560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.657

Rank 1 · LXL04_003322 · OH-1004

Golgi apparatus0.158

Rank 2 · LXL04_003322 · OH-1004

Nucleus0.124

Rank 3 · LXL04_003322 · OH-1004

Cytoplasm0.111

Rank 4 · LXL04_003322 · OH-1004

Cell membrane0.056

Rank 5 · LXL04_003322 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02458.21Transferase5-96 aa

PF01694.29Rhomboid121-272 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003322	`PF02458.21`	Transferase	5	96	1.9e-15	57.2
LXL04_003322	`PF01694.29`	Rhomboid	121	272	5.6e-22	79.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M1B5`	Arabidopsis thaliana	RHOMBOID-like protein 13	80.000%	Swiss-Prot	moderate database homology
`Q94CD1`	Arabidopsis thaliana	Omega-hydroxypalmitate O-feruloyl transferase	66.667%	Swiss-Prot	weak database homology
`Q9FFQ7`	Arabidopsis thaliana	Fatty alcohol:caffeoyl-CoA acyltransferase	53.659%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card