LXL04_003149 | RubberDandelionOmics

Gene overview

LXL04_003149

Reference: OH-1004 Chr: Chr01 Coordinates: 69249086-69251238 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1411 bp · LXL04_003149|LXL04_003149|OH1004|cDNA

atgTCTCTCTCTACATATCTCCTTTACACATCTCTCACATACGAAAAACACCATCGGCATCTTTCCGATTGGAAGATCCGACTCCTATCGCACAATActaacttgatcgtcggagcTGTCTCAGGTACCCGCCTTTCAAGTCTCCGACACCGCAGGCATCAATGTGAAGGGTCCGGGAAATCTGGGGCgcatcaagtggcgccatccgtgggaccttCGAACAAAAATCCCAACGTCTCACACGTCGATATCGTTTCTTC...

CDS

Download CDS FASTA

1059 bp · LXL04_003149|LXL04_003149|OH1004|CDS

ATGTCTCTCTCTACATATCTCCTTTACACATCTCTCACATACGAAAAACACCATCGGCATCTTTCCGATTGGAAGATCCGACTCCTATCGCACAATACTAACTTGATCGTCGGAGCTGTCTCAGGTACCCGCCTTTCAAGTCTCCGACACCGCAGGCATCAATGTGAAGGGTCCGGGAAATCTGGGGCGCATCAAGTGGCGCCATCCGTGGGACCTTCGAACAAAAATCCCAACGTCTCACACGTCGATATCGTTTCTTC...

Protein

Download Protein FASTA

352 aa · LXL04_003149|LXL04_003149|OH1004|PROTEIN

MSLSTYLLYTSLTYEKHHRHLSDWKIRLLSHNTNLIVGAVSGTRLSSLRHRRHQCEGSGKSGAHQVAPSVGPSNKNPNVSHVDIVSSEISTIEAITEIIMLLCVESCYTRTNPFNITMSKGSISAVMHLLGPPCKAILPNLHSKLGRPPTLDALPSAPNLRPPAVTKHHATPYLRHPSIMLLFLLCFLISYHQKSYAVDTMVVAESITDGDTVTSAGRIFKMGFFSPGIPRIGTFQLLQNQVYFNFNTLVIAIIIVPKLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003149`
TK1151 ID	TkA05G347330
OH-1004 ID	LXL04_003149
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	80.600
Protein coverage (%)	TK1151 49.630 / OH-1004 38.068 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003149

Location Chr01:69249086-69251238 (-)

Description Similar to SLSG: S-locus-specific glycoprotein S13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27290`	G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290.	No verified direct reference in this release
`At4g21380`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003149 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006955 immune response Biological Process

GO:0007165 signal transduction Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0060320 rejection of self pollen Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT4G21380

ath:AT4G27290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.281

Rank 1 · LXL04_003149 · OH-1004

Nucleus0.257

Rank 2 · LXL04_003149 · OH-1004

Cytoplasm0.224

Rank 3 · LXL04_003149 · OH-1004

Endoplasmic reticulum0.192

Rank 4 · LXL04_003149 · OH-1004

Extracellular0.139

Rank 5 · LXL04_003149 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453.31B_lectin260-320 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003149	`PF01453.31`	B_lectin	260	320	3.4e-14	53.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81832`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290	31.250%	Swiss-Prot	weak database homology
`O81905`	Arabidopsis thaliana	Receptor-like serine/threonine-protein kinase SD1-8	32.886%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card