LXL04_003014 | RubberDandelionOmics

Gene overview

LXL04_003014

Reference: OH-1004 Chr: Chr01 Coordinates: 64987114-64995744 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2991 bp · LXL04_003014|LXL04_003014|OH1004|cDNA

ATGGCTTTGGATTCAGTTCGTTTGGCAGGTGGAAAGAAAACGTTAGAAGCGGGTGGCTTTGTTCTCTTGGTCGGTGGAGATGCCTCTTTGAACAAAGGTGATCGGAAGAGGTTAAAGAATACTTTGGGCATGATCTGGGTGAAGGTCGATGTCCGGGAGAAGGTTGAGATGATTCCAAAGAAGacgttgttgctgttgctgGAGCGTATAAAAGGAACGGAAAAAATGGAGGACGTTCAAGGTAGTTTATTGTTGGCTAG...

CDS

Download CDS FASTA

2991 bp · LXL04_003014|LXL04_003014|OH1004|CDS

ATGGCTTTGGATTCAGTTCGTTTGGCAGGTGGAAAGAAAACGTTAGAAGCGGGTGGCTTTGTTCTCTTGGTCGGTGGAGATGCCTCTTTGAACAAAGGTGATCGGAAGAGGTTAAAGAATACTTTGGGCATGATCTGGGTGAAGGTCGATGTCCGGGAGAAGGTTGAGATGATTCCAAAGAAGACGTTGTTGCTGTTGCTGGAGCGTATAAAAGGAACGGAAAAAATGGAGGACGTTCAAGGTAGTTTATTGTTGGCTAG...

Protein

Download Protein FASTA

996 aa · LXL04_003014|LXL04_003014|OH1004|PROTEIN

MALDSVRLAGGKKTLEAGGFVLLVGGDASLNKGDRKRLKNTLGMIWVKVDVREKVEMIPKKTLLLLLERIKGTEKMEDVQGSLLLASGENSNVCKHCGNGGSNRDDFGRGRGRGRGSGKSRDGERFQRDKSHVKCFKCGEFGHYSNECPKWEKQEANLIEDESTTLDVTEVEVGCPEKVENQVRSSAGLRIPEGEIKLKFSTLTKCSKFETSEMVARFLGSTPLLPESWKLCARSNVMAPQGFLTDEVGGVTYVAFSGVQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003014`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003014

Location Chr01:64987114-64995744 (+)

Description Similar to PAD4: Lipase-like PAD4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g52430`	Probable lipase required downstream of MPK4 for accumulation of the plant defense-potentiating molecule, salicylic acid, thus contributing to the plant innate immunity against invasive biotrophic pathogens and to defense mechanisms upon recognition of microbe- associated molecular patterns (MAMPs).	Arabidopsis thaliana PAD4 encodes a lipase-like gene that is important for salicylic acid signaling.1999 · DOI: 10.1073/pnas.96.23.13583 Arabidopsis thaliana EDS4 contributes to salicylic acid (SA)-dependent expression of defense responses: evidence for inhibition of jasmonic acid signaling by SA.2000 · DOI: 10.1094/mpmi.2000.13.5.503 Fumonisin B1-induced cell death in arabidopsis protoplasts requires jasmonate-, ethylene-, and salicylate-dependent signaling pathways.2000 · DOI: 10.1105/tpc.12.10.1823 Direct interaction between the Arabidopsis disease resistance signaling proteins, EDS1 and PAD4.2001 · DOI: 10.1093/emboj/20.19.5400 The disease resistance signaling components EDS1 and PAD4 are essential regulators of the cell death pathway controlled by LSD1 in Arabidopsis.2001 · DOI: 10.1105/tpc.010085 EDS5, an essential component of salicylic acid-dependent signaling for disease resistance in Arabidopsis, is a member of the MATE transporter family.2002 · DOI: 10.1105/tpc.010376 Arabidopsis RPP4 is a member of the RPP5 multigene family of TIR-NB-LRR genes and confers downy mildew resistance through multiple signalling components.2002 · DOI: 10.1046/j.0960-7412.2001.01229.x Genetic evidence that expression of NahG modifies defence pathways independent of salicylic acid biosynthesis in the Arabidopsis-Pseudomonas syringae pv. tomato interaction.2003 · DOI: 10.1046/j.1365-313x.2003.01881.x LESION SIMULATING DISEASE 1 is required for acclimation to conditions that promote excess excitation energy.2004 · DOI: 10.1104/pp.104.043646 A key role for ALD1 in activation of local and systemic defenses in Arabidopsis.2004 · DOI: 10.1111/j.1365-313x.2004.02200.x The atypical resistance gene, RPW8, recruits components of basal defence for powdery mildew resistance in Arabidopsis.2005 · DOI: 10.1111/j.1365-313x.2005.02356.x Arabidopsis SENESCENCE-ASSOCIATED GENE101 stabilizes and signals within an ENHANCED DISEASE SUSCEPTIBILITY1 complex in plant innate immunity.2005 · DOI: 10.1105/tpc.105.033910 Premature leaf senescence modulated by the Arabidopsis PHYTOALEXIN DEFICIENT4 gene is associated with defense against the phloem-feeding green peach aphid.2005 · DOI: 10.1104/pp.105.070433 Genetic analysis of developmentally regulated resistance to downy mildew (Hyaloperonospora parasitica) in Arabidopsis thaliana.2005 · DOI: 10.1094/mpmi-18-1226 Arabidopsis MAP kinase 4 regulates salicylic acid- and jasmonic acid/ethylene-dependent responses via EDS1 and PAD4.2006 · DOI: 10.1111/j.1365-313x.2006.02806.x Plastidial fatty acid levels regulate resistance gene-dependent defense signaling in Arabidopsis.2007 · DOI: 10.1073/pnas.0609259104 Phloem-based resistance to green peach aphid is controlled by Arabidopsis PHYTOALEXIN DEFICIENT4 without its signaling partner ENHANCED DISEASE SUSCEPTIBILITY1.2007 · DOI: 10.1111/j.1365-313x.2007.03241.x Lysigenous aerenchyma formation in Arabidopsis is controlled by LESION SIMULATING DISEASE1.2007 · DOI: 10.1105/tpc.106.048843 Arabidopsis proteins important for modulating defense responses to Pseudomonas syringae that secrete HopW1-1.2008 · DOI: 10.1111/j.1365-313x.2008.03439.x PAD4-dependent antibiosis contributes to the ssi2-conferred hyper-resistance to the green peach aphid.2010 · DOI: 10.1094/mpmi-23-5-0618 Different roles of Enhanced Disease Susceptibility1 (EDS1) bound to and dissociated from Phytoalexin Deficient4 (PAD4) in Arabidopsis immunity.2011 · DOI: 10.1111/j.1469-8137.2011.03675.x SAG101 forms a ternary complex with EDS1 and PAD4 and is required for resistance signaling against turnip crinkle virus.2011 · DOI: 10.1371/journal.ppat.1002318 Discrimination of Arabidopsis PAD4 activities in defense against green peach aphid and pathogens.2012 · DOI: 10.1104/pp.112.193417 Natural variation in small molecule-induced TIR-NB-LRR signaling induces root growth arrest via EDS1- and PAD4-complexed R protein VICTR in Arabidopsis.2012 · DOI: 10.1105/tpc.112.107235 Lesion simulating disease1, enhanced disease susceptibility1, and phytoalexin deficient4 conditionally regulate cellular signaling homeostasis, photosynthesis, water use efficiency, and seed yield in Arabidopsis.2013 · DOI: 10.1104/pp.112.208116 Isolation of Arabidopsis mutants with enhanced disease susceptibility by direct screening.1996 · DOI: 10.1093/genetics/143.2.973 Phytoalexin-deficient mutants of Arabidopsis reveal that PAD4 encodes a regulatory factor and that four PAD genes contribute to downy mildew resistance.1997 · DOI: 10.1093/genetics/146.1.381 PAD4 functions upstream from salicylic acid to control defense responses in Arabidopsis.1998 · DOI: 10.1105/tpc.10.6.1021 Correlation of defense gene induction defects with powdery mildew susceptibility in Arabidopsis enhanced disease susceptibility mutants.1998 · DOI: 10.1046/j.1365-313x.1998.00319.x
`At3g48080`	Acts as a second functional copy of EDS1.	No verified direct reference in this release
`UniProt: Q9XF23`	Positive regulator of basal resistance and of effector-triggered immunity specifically mediated by TIR-NB-LRR resistance proteins.	No verified direct reference in this release
`At3g48090`	Positive regulator of basal resistance and of effector-triggered immunity specifically mediated by TIR-NB-LRR (TNL) resistance proteins.	EDS1, an essential component of R gene-mediated disease resistance in Arabidopsis has homology to eukaryotic lipases.1999 · DOI: 10.1073/pnas.96.6.3292 Direct interaction between the Arabidopsis disease resistance signaling proteins, EDS1 and PAD4.2001 · DOI: 10.1093/emboj/20.19.5400 Arabidopsis SENESCENCE-ASSOCIATED GENE101 stabilizes and signals within an ENHANCED DISEASE SUSCEPTIBILITY1 complex in plant innate immunity.2005 · DOI: 10.1105/tpc.105.033910 Balanced nuclear and cytoplasmic activities of EDS1 are required for a complete plant innate immune response.2010 · DOI: 10.1371/journal.ppat.1000970 Different roles of Enhanced Disease Susceptibility1 (EDS1) bound to and dissociated from Phytoalexin Deficient4 (PAD4) in Arabidopsis immunity.2011 · DOI: 10.1111/j.1469-8137.2011.03675.x Pathogen effectors target Arabidopsis EDS1 and alter its interactions with immune regulators.2011 · DOI: 10.1126/science.1211592 EDS1 contributes to nonhost resistance of Arabidopsis thaliana against Erwinia amylovora.2012 · DOI: 10.1094/mpmi-05-11-0111 Contrasting Roles of the Apoplastic Aspartyl Protease APOPLASTIC, ENHANCED DISEASE SUSCEPTIBILITY1-DEPENDENT1 and LEGUME LECTIN-LIKE PROTEIN1 in Arabidopsis Systemic Acquired Resistance.2014 · DOI: 10.1104/pp.114.239665
`At5g14930`	Acyl hydrolase that triggers the leaf senescence onset.	Different roles of Enhanced Disease Susceptibility1 (EDS1) bound to and dissociated from Phytoalexin Deficient4 (PAD4) in Arabidopsis immunity.2011 · DOI: 10.1111/j.1469-8137.2011.03675.x SAG101 forms a ternary complex with EDS1 and PAD4 and is required for resistance signaling against turnip crinkle virus.2011 · DOI: 10.1371/journal.ppat.1002318

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003014 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000304 response to singlet oxygen Biological Process

GO:0001666 response to hypoxia Biological Process

GO:0002213 defense response to insect Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009625 response to insect Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT3G48080

ath:AT3G48090

ath:AT3G52430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.495

Rank 1 · LXL04_003014 · OH-1004

Cytoplasm0.396

Rank 2 · LXL04_003014 · OH-1004

Cell membrane0.101

Rank 3 · LXL04_003014 · OH-1004

Endoplasmic reticulum0.064

Rank 4 · LXL04_003014 · OH-1004

Golgi apparatus0.044

Rank 5 · LXL04_003014 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00098.29zf-CCHC134-150 aa

PF01764.32Lipase_3308-413 aa

PF18117.7EDS1_EP605-813 aa

PF13966.12zf-RVT856-894 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003014	`PF00098.29`	zf-CCHC	134	150	4.6e-06	27.2
LXL04_003014	`PF01764.32`	Lipase_3	308	413	1.9e-18	67.4
LXL04_003014	`PF18117.7`	EDS1_EP	605	813	2.2e-71	240.6
LXL04_003014	`PF13966.12`	zf-RVT	856	894	7.9e-06	27.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S745`	Arabidopsis thaliana	Lipase-like PAD4	42.416%	Swiss-Prot	weak database homology
`Q9SU71`	Arabidopsis thaliana	Protein EDS1B	26.199%	Swiss-Prot	weak database homology
`Q9XF23`	Arabidopsis thaliana	Protein EDS1L	26.978%	Swiss-Prot	weak database homology
`Q9SU72`	Arabidopsis thaliana	Protein EDS1	27.439%	Swiss-Prot	weak database homology
`Q4F883`	Arabidopsis thaliana	Senescence-associated carboxylesterase 101	27.457%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card