LXL04_002871 | RubberDandelionOmics

Gene overview

LXL04_002871

Reference: OH-1004 Chr: Chr01 Coordinates: 60035195-60036188 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

858 bp · LXL04_002871|LXL04_002871|OH1004|cDNA

ATGGCTGAACATGCAAAGCCGACAACAACACAAGGAACTCCTGCCGCCAACAATCATCCAGTGACGACAAAGTCCGAAGTTAAGTCAAGCTCTATAAGCCGAATCACGTTACCTTTAACCTTATTCTCATTCCTTCTTTCTTTCCCTATCCTCTTTTGTGTGGTATGGCTTTTATACATAAGAGAGGGTAAATGCGAACACCTATTACCATTAGCAAATCTTCATATCGGGATTGTGTTTGGATTAATTCTCTTGTTTGT...

CDS

Download CDS FASTA

858 bp · LXL04_002871|LXL04_002871|OH1004|CDS

ATGGCTGAACATGCAAAGCCGACAACAACACAAGGAACTCCTGCCGCCAACAATCATCCAGTGACGACAAAGTCCGAAGTTAAGTCAAGCTCTATAAGCCGAATCACGTTACCTTTAACCTTATTCTCATTCCTTCTTTCTTTCCCTATCCTCTTTTGTGTGGTATGGCTTTTATACATAAGAGAGGGTAAATGCGAACACCTATTACCATTAGCAAATCTTCATATCGGGATTGTGTTTGGATTAATTCTCTTGTTTGT...

Protein

Download Protein FASTA

285 aa · LXL04_002871|LXL04_002871|OH1004|PROTEIN

MAEHAKPTTTQGTPAANNHPVTTKSEVKSSSISRITLPLTLFSFLLSFPILFCVVWLLYIREGKCEHLLPLANLHIGIVFGLILLFVISNGVVLLRSRFLMLGLMVVMVPLVVILTIGLTLIGSYMIDGRLMPGSPVWLNMMVNNDTNWYAIESCIYNTRTCQDLAIQSSMSSSHDLSTSKLSSIESGCCIPPSICDMKYVNATCWRKNHIGYRGSNGAYDIDCDLWQNDATKLCYDCNACRKGFIRTLREKWYKLGVFL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002871`
TK1151 ID	TkA01G415340
OH-1004 ID	LXL04_002871
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 82.143 / OH-1004 40.351 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002871

Location Chr01:60035195-60036188 (-)

Description Similar to TET15: Tetraspanin-15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57810`	May be involved in the regulation of cell differentiation.	No verified direct reference in this release
`At4g30430`	May be involved in the regulation of cell differentiation.	No verified direct reference in this release
`At4g28050`	May be involved in the regulation of cell differentiation.	No verified direct reference in this release
`At2g19580`	May be involved in the regulation of cell differentiation.	No verified direct reference in this release
`At3g45600`	May be involved in the regulation of cell differentiation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002871 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT2G19580

ath:AT3G45600

ath:AT4G28050

ath:AT4G30430

ath:AT5G57810

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.702

Rank 1 · LXL04_002871 · OH-1004

Lysosome / Vacuole0.118

Rank 2 · LXL04_002871 · OH-1004

Endoplasmic reticulum0.103

Rank 3 · LXL04_002871 · OH-1004

Cytoplasm0.094

Rank 4 · LXL04_002871 · OH-1004

Nucleus0.043

Rank 5 · LXL04_002871 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00335.27Tetraspanin39-273 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002871	`PF00335.27`	Tetraspanin	39	273	8.4e-10	39.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PDI1`	Arabidopsis thaliana	Tetraspanin-15	38.824%	Swiss-Prot	moderate database homology
`Q9M0B7`	Arabidopsis thaliana	Tetraspanin-9	31.746%	Swiss-Prot	moderate database homology
`Q9SUD4`	Arabidopsis thaliana	Tetraspanin-7	30.894%	Swiss-Prot	moderate database homology
`Q9ZUN5`	Arabidopsis thaliana	Tetraspanin-2	34.615%	Swiss-Prot	moderate database homology
`Q9M1E7`	Arabidopsis thaliana	Tetraspanin-3	29.482%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card