LXL04_002746 | RubberDandelionOmics

Gene overview

LXL04_002746

Reference: OH-1004 Chr: Chr01 Coordinates: 57254910-57257202 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1272 bp · LXL04_002746|LXL04_002746|OH1004|cDNA

ATGGCAGTGATGGCGGCCTTGGCGAGGGTGGCGCATCCTCTTAGCTCCCCCACTTTCATTACTCTTGCTTTGGACCGTACCTATAAGTACAGTGGCCGGACGCATAAACAACTCTTTCATGCTTGGAACATCCTCCAACACAAATCAAAAACCCAAAACCCATTTCCATCTCAAATTCTCACTGTTTCCAAGTCAGCCATGGCTACCAGAGACTCACTCCCTGTGAAAACTGCACAGCAGATGGCCATGGATGGCGATCA...

CDS

Download CDS FASTA

1272 bp · LXL04_002746|LXL04_002746|OH1004|CDS

ATGGCAGTGATGGCGGCCTTGGCGAGGGTGGCGCATCCTCTTAGCTCCCCCACTTTCATTACTCTTGCTTTGGACCGTACCTATAAGTACAGTGGCCGGACGCATAAACAACTCTTTCATGCTTGGAACATCCTCCAACACAAATCAAAAACCCAAAACCCATTTCCATCTCAAATTCTCACTGTTTCCAAGTCAGCCATGGCTACCAGAGACTCACTCCCTGTGAAAACTGCACAGCAGATGGCCATGGATGGCGATCA...

Protein

Download Protein FASTA

423 aa · LXL04_002746|LXL04_002746|OH1004|PROTEIN

MAVMAALARVAHPLSSPTFITLALDRTYKYSGRTHKQLFHAWNILQHKSKTQNPFPSQILTVSKSAMATRDSLPVKTAQQMAMDGDQPPPNYIFSNTTKSNYTKFGPLETSPPFASVPIVDISCFFSTSKQDDQETELAKLRSALSTWGCFQAVNHGLPYSYLDNVRQVIKQFFELPLEEKRKYFRETGSVEGYGNDMTYSENQAQDWCDRLFLRILPEDQRKLRFWPKIPSNLRETINDYTNKIKSISVVIFEAMAKSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002746`
TK1151 ID	TkAUNG035770
OH-1004 ID	LXL04_002746
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.200
Protein coverage (%)	TK1151 95.388 / OH-1004 93.853 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002746

Location Chr01:57254910-57257202 (-)

Description Similar to 2ODD11: 2-oxoglutarate-dependent dioxygenase 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17020`	Protein SRG1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0558700`	Involved in melatonin degradation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002746 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010150 leaf senescence Biological Process

GO:0032259 methylation Biological Process

GO:0097295 morphine biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0008168 methyltransferase activity Molecular Function

GO:0016682 oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor Molecular Function

GO:0016706 2-oxoglutarate-dependent dioxygenase activity Molecular Function

GO:0030782 (S)-tetrahydroprotoberberine N-methyltransferase activity Molecular Function

GO:0031418 L-ascorbic acid binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051213 dioxygenase activity Molecular Function

GO:0102802 thebaine 6-O-demethylase activity Molecular Function

KEGG gene cross-reference

ag:ADD85329

ag:ADD85331

ath:AT1G17020

dosa:Os10g0558700

osa:112935986

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.572

Rank 1 · LXL04_002746 · OH-1004

Nucleus0.367

Rank 2 · LXL04_002746 · OH-1004

Plastid0.192

Rank 3 · LXL04_002746 · OH-1004

Mitochondrion0.076

Rank 4 · LXL04_002746 · OH-1004

Peroxisome0.052

Rank 5 · LXL04_002746 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226.13DIOX_N117-229 aa

PF03171.272OG-FeII_Oxy282-376 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002746	`PF14226.13`	DIOX_N	117	229	2.6e-27	96.5
LXL04_002746	`PF03171.27`	2OG-FeII_Oxy	282	376	1.2e-30	106.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39224`	Arabidopsis thaliana	Protein SRG1	36.176%	Swiss-Prot	moderate database homology
`Q94LP4`	Oryza sativa subsp. japonica	2-oxoglutarate-dependent dioxygenase 11	37.222%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card