Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1302 bp · LXL04_002601|LXL04_002601|OH1004|cDNA
ATGGCGAGTTCTTCATCTTCGTCTTCCTCGGAGGTTTTGATTCAAACCCTAAGTAACCGAGGCTGGTGTTTACGTGATTTTGCTCAAGTCAACACGCTAATTGAAACCAAGTTTAATGGGAATTCTAGCACCGTTGGTTCTGTCGAGTCGGAGCTATGTAACATGGACTTACGAGCAATCGGAGGGAAAACTTTGCCTGACCTTTCCACCCTCCGAAAATTCTCTCACTTTGATGGCCCTAAAGTTCTCCAGGCAACTCA...
1302 bp · LXL04_002601|LXL04_002601|OH1004|CDS
ATGGCGAGTTCTTCATCTTCGTCTTCCTCGGAGGTTTTGATTCAAACCCTAAGTAACCGAGGCTGGTGTTTACGTGATTTTGCTCAAGTCAACACGCTAATTGAAACCAAGTTTAATGGGAATTCTAGCACCGTTGGTTCTGTCGAGTCGGAGCTATGTAACATGGACTTACGAGCAATCGGAGGGAAAACTTTGCCTGACCTTTCCACCCTCCGAAAATTCTCTCACTTTGATGGCCCTAAAGTTCTCCAGGCAACTCA...
Protein
Download Protein FASTA433 aa · LXL04_002601|LXL04_002601|OH1004|PROTEIN
MASSSSSSSSEVLIQTLSNRGWCLRDFAQVNTLIETKFNGNSSTVGSVESELCNMDLRAIGGKTLPDLSTLRKFSHFDGPKVLQATHNGELDIRALVSSARDISKSSVAESSGVSSGKRLLRLKLTDGHSDITAIEFTHIPSIPDNIVPGTKIRLENKVVMHSGILCLNAKAVTVLGGVVPSLYEEWEMNQKYAGFTRSTLKLSHGDDTGGPPPFEKFQAGVSSRQLNQQIRPSDNLKATSKASGPTVIEKGIKADSRDE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_002601 |
|---|---|
| TK1151 ID | TkA01G436850 |
| OH-1004 ID | LXL04_002601 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 94.600 |
| Protein coverage (%) | TK1151 72.577 / OH-1004 84.065Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_002601 |
|---|---|
| Location | Chr01:52708173-52710567 (-) |
| Description | Similar to TDRD3: Tudor domain-containing protein 3 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006265 DNA topological change Biological Process GO:0141194 siRNA-mediated heterochromatin formation Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005829 cytosol Cellular Component GO:0035145 exon-exon junction complex Cellular Component GO:0140225 DNA topoisomerase III-beta-TDRD3 complex Cellular Component GO:0003682 chromatin binding Molecular Function GO:0003713 transcription coactivator activity Molecular Function GO:0003723 RNA binding Molecular Function |
| KEGG gene cross-reference | bta:537918 gga:418823 mmu:219249 xtr:395019 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08585.19RMI1_N_C109-189 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_002601 | PF08585.19 | RMI1_N_C | 109 | 189 | 7.9e-18 | 65.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.