LXL04_002590 | RubberDandelionOmics

Gene overview

LXL04_002590

Reference: OH-1004 Chr: Chr01 Coordinates: 52518750-52519325 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

469 bp · LXL04_002590|LXL04_002590|OH1004|cDNA

ATGGGAAGACAGATGAGCTTCGGTGTTGATAGAAGGAAACCTAAAGATTCACCAGGAAAATGTGGGGATTCCATGCTTCATCTAGCTTCTAGAGGCGGTAATCTAGCAAAAGTTATAGAAATCTTTCAAAGCGTCGGCCTCGATGGATTATCGAAACAAAATCAAGAATGGGAAACTCCGCTTTATGTTGCTGCAGAAAATGGACACTCGCATGTCGTAGCACAGTTTCTGAAACACCTCGATCTTCAAACTGCCTCAAT...

CDS

Download CDS FASTA

336 bp · LXL04_002590|LXL04_002590|OH1004|CDS

ATGGGAAGACAGATGAGCTTCGGTGTTGATAGAAGGAAACCTAAAGATTCACCAGGAAAATGTGGGGATTCCATGCTTCATCTAGCTTCTAGAGGCGGTAATCTAGCAAAAGTTATAGAAATCTTTCAAAGCGTCGGCCTCGATGGATTATCGAAACAAAATCAAGAATGGGAAACTCCGCTTTATGTTGCTGCAGAAAATGGACACTCGCATGTCGTAGCACAGTTTCTGAAACACCTCGATCTTCAAACTGCCTCAAT...

Protein

Download Protein FASTA

111 aa · LXL04_002590|LXL04_002590|OH1004|PROTEIN

MGRQMSFGVDRRKPKDSPGKCGDSMLHLASRGGNLAKVIEIFQSVGLDGLSKQNQEWETPLYVAAENGHSHVVAQFLKHLDLQTASIAANNGYDPFHIAAKQGHLEVLKEL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002590`
TK1151 ID	TkA01G437720
OH-1004 ID	LXL04_002590
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.600
Protein coverage (%)	TK1151 41.618 / OH-1004 64.865 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002590

Location Chr01:52518750-52519325 (+)

Description Similar to At5g02620: Ankyrin repeat-containing protein At5g02620

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02620`	Ankyrin repeat-containing protein At5g02620.	No verified direct reference in this release
`At3g12360`	Involved in salt stress tolerance.	ITN1, a novel gene encoding an ankyrin-repeat protein that affects the ABA-mediated production of reactive oxygen species and is involved in salt-stress tolerance in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-313x.2008.03614.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0837000`	Involved in salt stress tolerance.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002590 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002027 regulation of heart rate Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0006897 endocytosis Biological Process

GO:0008104 intracellular protein localization Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0010881 regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion Biological Process

GO:0010882 regulation of cardiac muscle contraction by calcium ion signaling Biological Process

GO:0015031 protein transport Biological Process

GO:0031647 regulation of protein stability Biological Process

GO:0034394 protein localization to cell surface Biological Process

GO:0036309 protein localization to M-band Biological Process

KEGG gene cross-reference

ath:AT3G12360

ath:AT5G02620

dosa:Os01g0837000

hsa:287

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.559

Rank 1 · LXL04_002590 · OH-1004

Nucleus0.426

Rank 2 · LXL04_002590 · OH-1004

Cell membrane0.141

Rank 3 · LXL04_002590 · OH-1004

Endoplasmic reticulum0.065

Rank 4 · LXL04_002590 · OH-1004

Mitochondrion0.040

Rank 5 · LXL04_002590 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12796.14Ank_226-111 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002590	`PF12796.14`	Ank_2	26	111	2e-12	48.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6AWW5`	Arabidopsis thaliana	Ankyrin repeat-containing protein At5g02620	40.187%	Swiss-Prot	moderate database homology
`Q9C7A2`	Arabidopsis thaliana	Ankyrin repeat-containing protein ITN1	30.000%	Swiss-Prot	moderate database homology
`A2CIR5`	Oryza sativa subsp. japonica	Ankyrin repeat-containing protein NPR4	31.034%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card