LXL04_002074 | RubberDandelionOmics

Gene overview

LXL04_002074

Reference: OH-1004 Chr: Chr01 Coordinates: 41377317-41378429 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1113 bp · LXL04_002074|LXL04_002074|OH1004|cDNA

ATGGGAGACACAGAAAACACGCTTCCGCCTTCTAAGAAACGGGCTGCTGGAAGAGAATTATCACGAGATAACCCTGGTCtagatgatgaagaagatgatgttcttgatcaagaAGCAGGCACATTCAAGAAAGCCAGTGAAGAAGTTCTTGCCAATAGAAGAATTGTAAAAGTACGCCGAAAAACCCAAACACCATCTGCACCTTCATCTAACCCTTTTGCATCAATTCAATTAGTACCCCCTTCAGATCCCACTGCTGT...

CDS

Download CDS FASTA

1113 bp · LXL04_002074|LXL04_002074|OH1004|CDS

ATGGGAGACACAGAAAACACGCTTCCGCCTTCTAAGAAACGGGCTGCTGGAAGAGAATTATCACGAGATAACCCTGGTCTAGATGATGAAGAAGATGATGTTCTTGATCAAGAAGCAGGCACATTCAAGAAAGCCAGTGAAGAAGTTCTTGCCAATAGAAGAATTGTAAAAGTACGCCGAAAAACCCAAACACCATCTGCACCTTCATCTAACCCTTTTGCATCAATTCAATTAGTACCCCCTTCAGATCCCACTGCTGT...

Protein

Download Protein FASTA

370 aa · LXL04_002074|LXL04_002074|OH1004|PROTEIN

MGDTENTLPPSKKRAAGRELSRDNPGLDDEEDDVLDQEAGTFKKASEEVLANRRIVKVRRKTQTPSAPSSNPFASIQLVPPSDPTAVTIPNVQETEKTAPESVETESQDNAKKETGNEEEKEQESGNQKEEAECEATKESETKNVENDEKNNSFGSFQHLSSTQNAFTGLVGTGFSSSSFSFGSLTKGDSNSNSNSSPSFPSFGTTNGNSGIDKFDGIKTPSMQEVHVETGEENEKAVFTSDSILFEFLDGGWKERGKGE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002074`
TK1151 ID	TkA01G484670
OH-1004 ID	LXL04_002074
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002074

Location Chr01:41377317-41378429 (-)

Description Similar to NUP50A: Nuclear pore complex protein NUP50A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g52380`	Probably involved in nucleocytoplasmic transport via its interactions with importins and Ran, rather than by forming part of the nuclear pore complex (NPC) scaffolding.	No verified direct reference in this release
`At3g15970`	Probably involved in nucleocytoplasmic transport via its interactions with importins and Ran, rather than by forming part of the nuclear pore complex (NPC) scaffolding.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002074 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006406 mRNA export from nucleus Biological Process

GO:0006606 protein import into nucleus Biological Process

GO:0006607 NLS-bearing protein import into nucleus Biological Process

GO:0006611 protein export from nucleus Biological Process

GO:0006913 nucleocytoplasmic transport Biological Process

GO:0007281 germ cell development Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0035626 juvenile hormone mediated signaling pathway Biological Process

GO:0051028 mRNA transport Biological Process

GO:0051168 nuclear export Biological Process

GO:0051292 nuclear pore complex assembly Biological Process

GO:1900182 positive regulation of protein localization to nucleus Biological Process

KEGG gene cross-reference

ath:AT1G52380

ath:AT3G15970

dme:Dmel_CG11856

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.854

Rank 1 · LXL04_002074 · OH-1004

Cytoplasm0.248

Rank 2 · LXL04_002074 · OH-1004

Cell membrane0.028

Rank 3 · LXL04_002074 · OH-1004

Mitochondrion0.028

Rank 4 · LXL04_002074 · OH-1004

Golgi apparatus0.016

Rank 5 · LXL04_002074 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08911.17NUP5012-76 aa

PF00638.25Ran_BP1228-343 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002074	`PF08911.17`	NUP50	12	76	3e-16	60.4
LXL04_002074	`PF00638.25`	Ran_BP1	228	343	1.3e-18	68.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C829`	Arabidopsis thaliana	Nuclear pore complex protein NUP50A	47.297%	Swiss-Prot	moderate database homology
`Q9LW88`	Arabidopsis thaliana	Nuclear pore complex protein NUP50B	51.799%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card