RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_001367
Reference: OH-1004 Chr: Chr01 Coordinates: 25005335-25007730 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1077 bp · LXL04_001367|LXL04_001367|OH1004|cDNA

ATGTCTCAGGTAAACGAGAAAGATGCCGCGGCCAAGCCTGCCACAGCCACGGttttgtttttttatatatatatgtttttctTTTCCCATGCAGAAGAAAAGAAACCAGCCTCTGAATCAAGCTCCTCAGATACACAACCTGGAAGCATACCTCCCATGCCTTCCATGCCTGGAGCTGGATTCCCTGCAAATCCATTTGACTTTTCATCCATGGCTGGTCTACTCAACGACCCTAGCATTAAGGAATTAGCGGAACAAAT...

CDS

Download CDS FASTA

1077 bp · LXL04_001367|LXL04_001367|OH1004|CDS

ATGTCTCAGGTAAACGAGAAAGATGCCGCGGCCAAGCCTGCCACAGCCACGGTTTTGTTTTTTTATATATATATGTTTTTCTTTTCCCATGCAGAAGAAAAGAAACCAGCCTCTGAATCAAGCTCCTCAGATACACAACCTGGAAGCATACCTCCCATGCCTTCCATGCCTGGAGCTGGATTCCCTGCAAATCCATTTGACTTTTCATCCATGGCTGGTCTACTCAACGACCCTAGCATTAAGGAATTAGCGGAACAAAT...

Protein

Download Protein FASTA

358 aa · LXL04_001367|LXL04_001367|OH1004|PROTEIN

MSQVNEKDAAAKPATATVLFFYIYMFFFSHAEEKKPASESSSSDTQPGSIPPMPSMPGAGFPANPFDFSSMAGLLNDPSIKELAEQIAKDPSFNQMAEQLQQTFHAPDEGVPQFDTQQYYSTMQQVMQNPQFMTMAERLGNAMMQDPSMSQMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIESGGPTAMMRYWNDQDVLKKLGEAMGLAVSEDATAASAGNEPEEDTNEDESIVHQTASVGDVEGLKKALESGADK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_001367
TK1151 IDTkA01G542520
OH-1004 IDLXL04_001367
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)93.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_001367
LocationChr01:25005335-25007730 (-)
DescriptionSimilar to AKR2B: Ankyrin repeat domain-containing protein 2B
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g17390 Exhibits chaperone activity toward chloroplast outer envelope membrane, mitochondrion outer membrane, endoplasmic reticulum membrane and peroxisomal proteins, by recruiting specific proteins containing a single transmembrane associated with an AKR2A-binding sequence (ABS) and subsequently binding glycolipids (e.g. monogalactosyldiacylglycerol (MGDG) and phosphatidylglycerol (PG)) present in the membrane of the target organelle. No verified direct reference in this release
At4g35450 Exhibits chaperone activity toward chloroplast outer envelope membrane, mitochondrion outer membrane, endoplasmic reticulum membrane and peroxisomal proteins, by recruiting specific proteins containing a single transmembrane associated with an AKR2A-binding sequence (ABS) and subsequently binding glycolipids (e.g. monogalactosyldiacylglycerol (MGDG) and phosphatidylglycerol (PG)) present in the membrane of the target organelle.
An ankyrin repeat-containing protein plays a role in both disease resistance and antioxidation metabolism.2002 · DOI: 10.1046/j.0960-7412.2001.01205.x
AKR2A-mediated import of chloroplast outer membrane proteins is essential for chloroplast biogenesis.2008 · DOI: 10.1038/ncb1683
ANKYRIN REPEAT-CONTAINING PROTEIN 2A is an essential molecular chaperone for peroxisomal membrane-bound ASCORBATE PEROXIDASE3 in Arabidopsis.2010 · DOI: 10.1105/tpc.109.065979

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_001367 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0000209 protein polyubiquitination Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006457 protein folding Biological Process
GO:0007052 mitotic spindle organization Biological Process
GO:0009791 post-embryonic development Biological Process
GO:0010228 vegetative to reproductive phase transition of meristem Biological Process
GO:0015031 protein transport Biological Process
GO:0016055 Wnt signaling pathway Biological Process
GO:0018105 peptidyl-serine phosphorylation Biological Process
GO:0018107 peptidyl-threonine phosphorylation Biological Process
GO:0032210 regulation of telomere maintenance via telomerase Biological Process
GO:0032212 positive regulation of telomere maintenance via telomerase Biological Process
KEGG gene cross-reference
ath:AT2G17390
ath:AT4G35450
hsa:8658
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.444
Rank 1 · LXL04_001367 · OH-1004
Peroxisome0.277
Rank 2 · LXL04_001367 · OH-1004
Mitochondrion0.244
Rank 3 · LXL04_001367 · OH-1004
Nucleus0.179
Rank 4 · LXL04_001367 · OH-1004
Endoplasmic reticulum0.104
Rank 5 · LXL04_001367 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17830.7STI1-HOP_DP167-211 aa
PF12796.14Ank_2226-295 aa
PF24521.3Ank_KRIT1232-346 aa
PF12796.14Ank_2239-329 aa
PF13637.13Ank_4245-287 aa
PF00023.37Ank267-298 aa
PF13637.13Ank_4274-320 aa
PF13857.13Ank_5286-340 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_001367PF17830.7STI1-HOP_DP1672113.6e-1453.1
LXL04_001367PF12796.14Ank_22262951.6e-39135.1
LXL04_001367PF24521.3Ank_KRIT12323463.5e-0730.8
LXL04_001367PF12796.14Ank_22393291.6e-39135.1
LXL04_001367PF13637.13Ank_42452876.5e-2174.6
LXL04_001367PF00023.37Ank2672982.2e-1969.2
LXL04_001367PF13637.13Ank_42743206.5e-2174.6
LXL04_001367PF13857.13Ank_52863401.2e-1351.8
LXL04_001367PF12796.14Ank_22913521.6e-39135.1
LXL04_001367PF00023.37Ank2993302.2e-1969.2
LXL04_001367PF13606.13Ank_33003264.8e-1348.6
LXL04_001367PF13637.13Ank_43043526.5e-2174.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q29Q26Arabidopsis thalianaAnkyrin repeat domain-containing protein 2B69.069%Swiss-Protstrong database homology
Q9SAR5Arabidopsis thalianaAnkyrin repeat domain-containing protein 2A70.358%Swiss-Protstrong database homology

JBrowse

View in Genome Browser