LXL04_001291 | RubberDandelionOmics

Gene overview

LXL04_001291

Reference: OH-1004 Chr: Chr01 Coordinates: 23528558-23532835 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3606 bp · LXL04_001291|LXL04_001291|OH1004|cDNA

ATggcttcttcttcatcttcttccatGGCAACTGCTCAACGATGTTTTAGTCATGATGTCTTTTTAAGTTTTCGAGGGGAAACTCGTCACCAATTTACGGATCATCTCCATCAAGCATTGAAGCGAGAACGAATACGCATTTTCCGGGATGATGGAATTGAGAGAGGAAAAATACTGAAGGACGAGCTAGAGAAAGCCATCCATGAATCTGAGATCTCACTCGTTGTCTTCTCAGACGACTATGCATCCTCCAAATGGTG...

CDS

Download CDS FASTA

3606 bp · LXL04_001291|LXL04_001291|OH1004|CDS

ATGGCTTCTTCTTCATCTTCTTCCATGGCAACTGCTCAACGATGTTTTAGTCATGATGTCTTTTTAAGTTTTCGAGGGGAAACTCGTCACCAATTTACGGATCATCTCCATCAAGCATTGAAGCGAGAACGAATACGCATTTTCCGGGATGATGGAATTGAGAGAGGAAAAATACTGAAGGACGAGCTAGAGAAAGCCATCCATGAATCTGAGATCTCACTCGTTGTCTTCTCAGACGACTATGCATCCTCCAAATGGTG...

Protein

Download Protein FASTA

1201 aa · LXL04_001291|LXL04_001291|OH1004|PROTEIN

MASSSSSSMATAQRCFSHDVFLSFRGETRHQFTDHLHQALKRERIRIFRDDGIERGKILKDELEKAIHESEISLVVFSDDYASSKWCLHEVMMIIKEHETSSHKHDLVPVFYKVDTSDVKHQTGSFKKAFDDYEDEIKAETDLKKKTELALKVRAWRDSLNKATNFTGYVYEIGYESEFIKKVVDTVISKIDYKLLYVSDKLVGIDEDVAEIQPWLQDTSPDAVVLLIDGMGGIGKSTIAKCIFNLHFRNYDASCFLADI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001291`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001291

Location Chr01:23528558-23532835 (-)

Description Similar to RUN1: Disease resistance protein RUN1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g56510`	TIR-NB-LRR receptor-like protein that confers broad-spectrum resistance and full immunity to several races of the pathogen Albugo candida (white rust disease).	WRR4 encodes a TIR-NB-LRR protein that confers broad-spectrum white rust resistance in Arabidopsis thaliana to four physiological races of Albugo candida.2008 · DOI: 10.1094/mpmi-21-6-0757 Activation tagging of ADR2 conveys a spreading lesion phenotype and resistance to biotrophic pathogens.2009 · DOI: 10.1111/j.1469-8137.2009.02902.x Arabidopsis thaliana natural variation reveals connections between UV radiation stress and plant pathogen-like defense responses.2015 · DOI: 10.1016/j.plaphy.2015.01.011

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001291 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003953 NAD+ nucleosidase activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0043531 ADP binding Molecular Function

GO:0050135 NADP+ nucleosidase activity Molecular Function

GO:0061809 NAD+ nucleosidase activity, cyclic ADP-ribose generating Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.447

Rank 1 · LXL04_001291 · OH-1004

Nucleus0.320

Rank 2 · LXL04_001291 · OH-1004

Cell membrane0.273

Rank 3 · LXL04_001291 · OH-1004

Endoplasmic reticulum0.096

Rank 4 · LXL04_001291 · OH-1004

Lysosome / Vacuole0.040

Rank 5 · LXL04_001291 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01582.26TIR18-191 aa

PF13676.12TIR_220-116 aa

PF00931.29NB-ARC207-376 aa

PF23282.2WHD_ROQ1448-516 aa

PF23598.2LRR_14765-830 aa

PF13855.13LRR_8782-818 aa

PF12799.14LRR_4787-828 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001291	`PF01582.26`	TIR	18	191	7.2e-35	121.1
LXL04_001291	`PF13676.12`	TIR_2	20	116	1.2e-15	58.7
LXL04_001291	`PF00931.29`	NB-ARC	207	376	1e-21	78.0
LXL04_001291	`PF23282.2`	WHD_ROQ1	448	516	1.5e-20	73.8
LXL04_001291	`PF23598.2`	LRR_14	765	830	8.8e-06	25.4
LXL04_001291	`PF13855.13`	LRR_8	782	818	3.7e-08	33.7
LXL04_001291	`PF12799.14`	LRR_4	787	828	1.3e-07	32.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C7X0`	Arabidopsis thaliana	Disease resistance protein ADR2	31.057%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card