LXL04_000990 | RubberDandelionOmics

Gene overview

LXL04_000990

Reference: OH-1004 Chr: Chr01 Coordinates: 17918697-17920652 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1182 bp · LXL04_000990|LXL04_000990|OH1004|cDNA

ATGTTAGCCCAGAAGTCCTCCACCTTCCCCTTATCTCTCAGAATTCGAACTATCAACAGCGCAAAAATGTCGATTATACATCAAAATTTCTTCACGAACAACCTTCAATGGGTTCCCAGTACACATCCACCCAATACTCTCAATCATACTCGCCCTATTACTCGAATCTTCACATCTTCTACACGATCCTCATCATTAGACAAGAGGTTTAACAGCAGATTATCGCTCAGTACAAACGGTGGCTATGTGAAGTCATCGTT...

CDS

Download CDS FASTA

1182 bp · LXL04_000990|LXL04_000990|OH1004|CDS

ATGTTAGCCCAGAAGTCCTCCACCTTCCCCTTATCTCTCAGAATTCGAACTATCAACAGCGCAAAAATGTCGATTATACATCAAAATTTCTTCACGAACAACCTTCAATGGGTTCCCAGTACACATCCACCCAATACTCTCAATCATACTCGCCCTATTACTCGAATCTTCACATCTTCTACACGATCCTCATCATTAGACAAGAGGTTTAACAGCAGATTATCGCTCAGTACAAACGGTGGCTATGTGAAGTCATCGTT...

Protein

Download Protein FASTA

393 aa · LXL04_000990|LXL04_000990|OH1004|PROTEIN

MLAQKSSTFPLSLRIRTINSAKMSIIHQNFFTNNLQWVPSTHPPNTLNHTRPITRIFTSSTRSSSLDKRFNSRLSLSTNGGYVKSSFDYNNHNGGNANNGHYEYEKGLLGNSSHQYPRPTEVPWTKELCNSVQLIGNVGTPVEFKQLSSGKVLAWCRLAVKKSSTDTTWISLTFWDDLAHIASKYVEKGQQIYVSGRIVSDTVDSDDGKQQTYYKVVVQQLNFVEKSPLSNDQDFNYNSNSNSNSNSNSSSMTTGNYFLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000990`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000990

Location Chr01:17918697-17920652 (-)

Description Similar to OSB4: Protein OSB4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31010`	Binds single-stranded DNA.	No verified direct reference in this release
`At1g47720`	Regulates mitochondrial DNA recombination.	The plant-specific ssDNA binding protein OSB1 is involved in the stoichiometric transmission of mitochondrial DNA in Arabidopsis.2006 · DOI: 10.1105/tpc.106.042028
`At4g20010`	Binds preferentially single-stranded DNA.	No verified direct reference in this release
`At5g44785`	Binds single-stranded DNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000990 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000001 mitochondrion inheritance Biological Process

GO:0006260 DNA replication Biological Process

GO:0045910 negative regulation of DNA recombination Biological Process

GO:0090297 positive regulation of mitochondrial DNA replication Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0042644 chloroplast nucleoid Cellular Component

GO:0042645 mitochondrial nucleoid Cellular Component

GO:0048046 apoplast Cellular Component

GO:0003697 single-stranded DNA binding Molecular Function

GO:0008047 enzyme activator activity Molecular Function

KEGG gene cross-reference

ath:AT1G31010

ath:AT1G47720

ath:AT4G20010

ath:AT5G44785

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.704

Rank 1 · LXL04_000990 · OH-1004

Plastid0.233

Rank 2 · LXL04_000990 · OH-1004

Nucleus0.068

Rank 3 · LXL04_000990 · OH-1004

Cytoplasm0.050

Rank 4 · LXL04_000990 · OH-1004

Cell membrane0.009

Rank 5 · LXL04_000990 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30940.1OSB_SSB127-224 aa

PF00436.32SSB130-223 aa

PF30937.1OSB_PDF316-368 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000990	`PF30940.1`	OSB_SSB	127	224	1.6e-24	86.7
LXL04_000990	`PF00436.32`	SSB	130	223	2.8e-19	69.8
LXL04_000990	`PF30937.1`	OSB_PDF	316	368	8.4e-21	73.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FYJ2`	Arabidopsis thaliana	Protein OSB4, chloroplastic	28.378%	Swiss-Prot	weak database homology
`Q9SX99`	Arabidopsis thaliana	Protein OSB1, mitochondrial	27.737%	Swiss-Prot	weak database homology
`Q8GXH3`	Arabidopsis thaliana	Protein OSB2, chloroplastic	36.000%	Swiss-Prot	weak database homology
`Q8GWJ4`	Arabidopsis thaliana	Protein OSB3, chloroplastic/mitochondrial	26.877%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card