LXL04_000313 | RubberDandelionOmics

Gene overview

LXL04_000313

Reference: OH-1004 Chr: Chr01 Coordinates: 5854149-5855663 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1515 bp · LXL04_000313|LXL04_000313|OH1004|cDNA

ATGGATACTTTGTTGAGGACTCACAGTTCGTTCGAATTTCTCCACCCACTTCACAGATTTGCAGGAAATCTGACCAATTTGAGTTCATCCAAGTCTCAAATTCACGAACCTAGATTAAGCCCTAAAAAATCCCATCTAAAATGGAGTCATGGAGGTTGTGTTAAGGCCAGTAGTAGTGCTCTACTAGAACTCGTACCGGAAATCAAGAAAGAAAACCTCGATTTCGAGCTTCCTCTCTATGACCCTTCAAAGGGTGTCGT...

CDS

Download CDS FASTA

1515 bp · LXL04_000313|LXL04_000313|OH1004|CDS

ATGGATACTTTGTTGAGGACTCACAGTTCGTTCGAATTTCTCCACCCACTTCACAGATTTGCAGGAAATCTGACCAATTTGAGTTCATCCAAGTCTCAAATTCACGAACCTAGATTAAGCCCTAAAAAATCCCATCTAAAATGGAGTCATGGAGGTTGTGTTAAGGCCAGTAGTAGTGCTCTACTAGAACTCGTACCGGAAATCAAGAAAGAAAACCTCGATTTCGAGCTTCCTCTCTATGACCCTTCAAAGGGTGTCGT...

Protein

Download Protein FASTA

504 aa · LXL04_000313|LXL04_000313|OH1004|PROTEIN

MDTLLRTHSSFEFLHPLHRFAGNLTNLSSSKSQIHEPRLSPKKSHLKWSHGGCVKASSSALLELVPEIKKENLDFELPLYDPSKGVVVDLVVVGGGPSGLAVAQQVSEAGLTVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSSAVVYIDENSTKNLGRPYGRVNRKQLKSKMLKKCISNGVKFHQAKVIKVIHEELKSLLICNDGVTIQATLVLDATGFSRSLVQYDKPYNPGYQVAYGILAEVEEHPFDVDK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000313`
TK1151 ID	TkA01G620610
OH-1004 ID	LXL04_000313
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000313

Location Chr01:5854149-5855663 (-)

Description Similar to LCY1: Lycopene beta cyclase, chloroplastic/chromoplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g10230`	Involved in carotenoid biosynthesis.	Lutein accumulation in the absence of zeaxanthin restores nonphotochemical quenching in the Arabidopsis thaliana npq1 mutant.2009 · DOI: 10.1105/tpc.109.066571

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000313 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006744 ubiquinone biosynthetic process Biological Process

GO:0016117 carotenoid biosynthetic process Biological Process

GO:0016123 xanthophyll biosynthetic process Biological Process

GO:1901812 beta-carotene biosynthetic process Biological Process

GO:1901818 beta-zeacarotene biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009509 chromoplast Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0046862 chromoplast membrane Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

KEGG gene cross-reference

ag:CAA57386

ag:CAA60119

ath:AT3G10230

cann:107869983

nta:107763207

sly:544104

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.978

Rank 1 · LXL04_000313 · OH-1004

Mitochondrion0.031

Rank 2 · LXL04_000313 · OH-1004

Cytoplasm0.019

Rank 3 · LXL04_000313 · OH-1004

Nucleus0.018

Rank 4 · LXL04_000313 · OH-1004

Peroxisome0.014

Rank 5 · LXL04_000313 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07992.21Pyr_redox_288-228 aa

PF05834.19Lycopene_cycl89-481 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000313	`PF07992.21`	Pyr_redox_2	88	228	4.4e-07	30.3
LXL04_000313	`PF05834.19`	Lycopene_cycl	89	481	1.7e-146	488.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38933`	Arabidopsis thaliana	Lycopene beta cyclase, chloroplastic	77.075%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card