TkA08G166370 | RubberDandelionOmics

Gene overview

TkA08G166370

Reference: TK1151 Chr: Chr08 Coordinates: 43508001-43511853 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1386 bp · TkA08G166370|TK1151|cDNA

AACAGAAAAATACAAGAGCTTTAAAAGAGAACGTGAGAGATTGAGAGAGAGAAAGGAGAACGGGCCAAGGCGTGCTTCTCTGTGATTCCTCCTCTCTCTCTGCTCACTTTCTTTCTCTCTCTCTCTCACAAAGCCGCACCAAACAATAGCTATTAATTAAGATTCTTTTCGACTTGCATATGCAAATCGAAAACGATTAATATGAAGCTGTAAATCGATCAGAAAAATGAATTAAGATTCAGTGATTTCTCTTTGAAGGT...

CDS

Download CDS FASTA

774 bp · TkA08G166370|TK1151|CDS

ATGGCGTCGTCCATGATGATTTTGGATCCGGTAACGAATAACATGGATAGAGCTCGTGATTCATCGAAGCGGCGAAAGAAGAAGAAAAATCAGAGGCACTCTAGCGATGGTGGGAGCGATCAGACGAATCGGAACTCGAATAACAATAACAATCAGATTATGACGTGGAAATCCGAAGCTCAGCAGCAAGTATACAGCTCGAAACTCTTGCAAGCGCTCCGCAATGTCCGGGTCAGCTCCGGCACGTCTCCTCCTTCCGC...

Protein

Download Protein FASTA

257 aa · TkA08G166370|TK1151|PROTEIN

MASSMMILDPVTNNMDRARDSSKRRKKKKNQRHSSDGGSDQTNRNSNNNNNQIMTWKSEAQQQVYSSKLLQALRNVRVSSGTSPPSAPCRGRAVREAADRVLAVTAKGRSRWSRAILTNKIKLKFMKNNRRQRGTAVTATRNSRLKKPRVSILKLKTKNLPAVQRKTRVLGRLVPGCRKQPLPVVLEEATDYIAALEMQVKAMAALANLLSGGSSSSSGTGTGTGAMILNQLSPRQPPPSLYTEPETMVHRTGDEPK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G166370`
TK1151 ID	TkA08G166370
OH-1004 ID	LXL04_032325
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 71.191 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G166370

Location Chr08:43508001-43511853 (-)

Description Similar to BHLH147: Transcription factor bHLH147

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06590`	bHLH transcription factor that binds DNA on specific sequence 5'-CANNTG-3' in target gene promoters.	No verified direct reference in this release
`At3g17100`	Atypical bHLH transcription factor probably unable to bind DNA.	No verified direct reference in this release
`At1g09250`	Atypical bHLH transcription factor probably unable to bind DNA.	No verified direct reference in this release
`At3g05800`	Atypical bHLH transcription factor probably unable to bind DNA.	Regulation of Arabidopsis brassinosteroid signaling by atypical basic helix-loop-helix proteins.2009 · DOI: 10.1105/tpc.109.072504

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032325 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G09250

ath:AT2G43060

ath:AT3G05800

ath:AT3G06590

ath:AT3G17100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.970

Rank 1 · TkA08G166370 · TK1151

Cytoplasm0.064

Rank 2 · TkA08G166370 · TK1151

Cell membrane0.033

Rank 3 · TkA08G166370 · TK1151

Endoplasmic reticulum0.025

Rank 4 · TkA08G166370 · TK1151

Plastid0.017

Rank 5 · TkA08G166370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09531Ndc1_Nup5-111 aa

PF11169DUF295615-56 aa

PF19610DUF611517-71 aa

PF26576IBH1_N29-29 aa

PF26576IBH1_N60-119 aa

PF19610DUF6115140-156 aa

PF23173bHLH_SAC51166-199 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G166370	`PF09531`	Ndc1_Nup	5	111	1.2	8.5
TkA08G166370	`PF11169`	DUF2956	15	56	0.41	11.6
TkA08G166370	`PF19610`	DUF6115	17	71	4.0	8.6
TkA08G166370	`PF26576`	IBH1_N	29	29	2.1e-10	41.0
TkA08G166370	`PF26576`	IBH1_N	60	119	2.1e-10	41.0
TkA08G166370	`PF19610`	DUF6115	140	156	4.0	8.6
TkA08G166370	`PF23173`	bHLH_SAC51	166	199	0.014	16.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8Z9`	Arabidopsis thaliana	sp\|Q9C8Z9\|BH148_ARATH Transcription factor bHLH148	58.200%	Swiss-Prot	Medium
`Q9LSN7`	Arabidopsis thaliana	sp\|Q9LSN7\|BH147_ARATH Transcription factor bHLH147	56.800%	Swiss-Prot	Medium
`O80482`	Arabidopsis thaliana	sp\|O80482\|BH149_ARATH Transcription factor bHLH149	45.100%	Swiss-Prot	Medium
`Q9M9L6`	Arabidopsis thaliana	sp\|Q9M9L6\|BH150_ARATH Transcription factor bHLH150	40.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card