TkA07G345980 | RubberDandelionOmics

Gene overview

TkA07G345980

Reference: TK1151 Chr: Chr07 Coordinates: 86477801-86485936 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

7950 bp · TkA07G345980|TK1151|cDNA

TTTGGATATGGGTTTTTTAGTTTCCGGTTCGATTTCTGCCCGTACTACCAAAAAGGTTATCTTTCTAAATCACAAAAAACTGTTCACTCCTAGAGTGTCAGAATGTCCCCCATTTCTACCATAAACAGACTCTTCTTATCCTTTGTTCATCTCTTTTGTTCGAATAGGAGTAGGGTTTAGCTACAACGGTTTCGCGAATCAGGTGATTGCTTTTTACTAATTTACTTACACATCCACCGTTTTATCTTGTGATATTCATG...

CDS

Download CDS FASTA

1017 bp · TkA07G345980|TK1151|CDS

ATGTTCCGCTCAAGGGATCTCAAATATCGCGTGGGCCCTCTCGAAATCGGAGGCGAGCTTCTTTACGTGTCTGAAATGGACCGAGTTGCAGAAGTCGCGTTGACCAAAGTTGACCAGTTCAATTCCCAAAATGTCGCGAATGTTTCCGGTGCTTTTGCATCCATGCAGCATTCCGCTCCAGGGTTATTTTCGGAATTATCAAAAAGAGGTTCGGAAATTGTCTCCACTTTTCTACCTCAAGAACTTGCTCAAGTCCTATG...

Protein

Download Protein FASTA

338 aa · TkA07G345980|TK1151|PROTEIN

MFRSRDLKYRVGPLEIGGELLYVSEMDRVAEVALTKVDQFNSQNVANVSGAFASMQHSAPGLFSELSKRGSEIVSTFLPQELAQVLWAFASLFEPADLLLSSLDNVYQNTLQFTCKKTPNPNLEPSKDENTLPVLEFNRDEIGNICWSYAVLGEMNRTFFFNIWKTLENFEEQNVSEQYREDIMFATQVHLVNQCLKVEYPHLSLCLKTEIEDKIIRAGKTTRFNQKITSSFQKEVARLLVSTGVDWIREYVVDGYTLDA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G345980`
TK1151 ID	TkA07G345980
OH-1004 ID	LXL04_029771
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.800
Protein coverage (%)	TK1151 95.858 / OH-1004 50.077 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G345980

Location Chr07:86477801-86485936 (-)

Description Similar to RAP: RAP domain-containing protein, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g31890`	RNA-binding protein required for chloroplast 16S rRNA maturation, an important process which supports chloroplast gene expression and biogenesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0425000`	Probable RNA-binding protein that plays an essential role in chloroplast development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029771 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000963 mitochondrial RNA processing Biological Process

GO:0006952 defense response Biological Process

GO:0044528 regulation of mitochondrial mRNA stability Biological Process

GO:1901259 chloroplast rRNA processing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0035770 ribonucleoprotein granule Cellular Component

GO:0042644 chloroplast nucleoid Cellular Component

GO:0042646 plastid nucleoid Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G31890

dosa:Os03g0425000

osa:4333151

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.488

Rank 1 · TkA07G345980 · TK1151

Cytoplasm0.226

Rank 2 · TkA07G345980 · TK1151

Nucleus0.167

Rank 3 · TkA07G345980 · TK1151

Plastid0.105

Rank 4 · TkA07G345980 · TK1151

Peroxisome0.049

Rank 5 · TkA07G345980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26188RESC626-92 aa

PF07671DUF160137-47 aa

PF07671DUF160175-86 aa

PF18741MTES_1575232-311 aa

PF04480DUF559243-308 aa

PF08373RAP269-325 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G345980	`PF26188`	RESC6	26	92	2.9e-05	24.0
TkA07G345980	`PF07671`	DUF1601	37	47	0.09	13.3
TkA07G345980	`PF07671`	DUF1601	75	86	0.09	13.3
TkA07G345980	`PF18741`	MTES_1575	232	311	1.5e-07	32.1
TkA07G345980	`PF04480`	DUF559	243	308	0.00097	19.7
TkA07G345980	`PF08373`	RAP	269	325	6.9e-18	65.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZE7`	Arabidopsis thaliana	sp\|Q8VZE7\|RAP_ARATH RAP domain-containing protein, chloroplastic	64.700%	Swiss-Prot	High
`Q84MH1`	Oryza sativa subsp. japonica	sp\|Q84MH1\|RAP_ORYSJ RAP domain-containing protein, chloroplastic	57.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card