TkA07G260370 | RubberDandelionOmics

Gene overview

TkA07G260370

Reference: TK1151 Chr: Chr07 Coordinates: 65105568-65106586 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

762 bp · TkA07G260370|TK1151|cDNA

ATGAATTTAGATGAGGGCAATTTCGTCCTTTCACTTAATATTACAATTGCCTCCTTAAGCTTCCTGAAGTACTTTACCTTTACAACAACAATCTCACCAGTGACCTCCCTGTTGGCGTCTCGATGCCCTTCGTCACCTCCACCTGGACGGAAACTACTTTTCACCGGCGGCATTCCTCAGAAGCTCGGCAAGAACGGGAAGCTGGGAATCCTTGATTTAACTTCTTGCTTGGCCCAATTCCGGAATTGCTGGGTCAATGT...

CDS

Download CDS FASTA

762 bp · TkA07G260370|TK1151|CDS

ATGAATTTAGATGAGGGCAATTTCGTCCTTTCACTTAATATTACAATTGCCTCCTTAAGCTTCCTGAAGTACTTTACCTTTACAACAACAATCTCACCAGTGACCTCCCTGTTGGCGTCTCGATGCCCTTCGTCACCTCCACCTGGACGGAAACTACTTTTCACCGGCGGCATTCCTCAGAAGCTCGGCAAGAACGGGAAGCTGGGAATCCTTGATTTAACTTCTTGCTTGGCCCAATTCCGGAATTGCTGGGTCAATGT...

Protein

Download Protein FASTA

253 aa · TkA07G260370|TK1151|PROTEIN

MNLDEGNFVLSLNITIASLSFLKYFTFTTTISPVTSLLASRCPSSPPPGRKLLFTGGIPQKLGKNGKLGILDLTSCLAQFRNCWVNVELQENLLSGAFLVTDFVSSNLGQDAIGFGKDAIGGRNGRIYVVTDPHNDNPVNPVPGTLRYGVIQDEPLWIIFKRDMVIQLRQELVMNSFKTIDGRGVNVHIGNGPCITIHDATNIIIHGIHIHDCEQAGNGYIRNSPHHSGWWRQSDGDGITVDLLIKICNCNIK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G260370`
TK1151 ID	TkA07G260370
OH-1004 ID	LXL04_029001
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G260370

Location Chr07:65105568-65106586 (-)

Description Similar to Pectate lyase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63180`	Probable pectate lyase 22.	No verified direct reference in this release
`At4g24780`	Probable pectate lyase 18.	No verified direct reference in this release
`At3g27400`	Putative pectate lyase 11.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029001 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0045490 pectin catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009536 plastid Cellular Component

GO:0030570 pectate lyase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G04680

ath:AT3G07010

ath:AT5G63180

sly:778293

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.244

Rank 1 · TkA07G260370 · TK1151

Extracellular0.213

Rank 2 · TkA07G260370 · TK1151

Endoplasmic reticulum0.169

Rank 3 · TkA07G260370 · TK1151

Cytoplasm0.167

Rank 4 · TkA07G260370 · TK1151

Plastid0.114

Rank 5 · TkA07G260370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Z25`	Arabidopsis thaliana	sp\|Q93Z25\|PLY22_ARATH Probable pectate lyase 22	73.600%	Swiss-Prot	Medium
`Q9C5M8`	Arabidopsis thaliana	sp\|Q9C5M8\|PLY18_ARATH Probable pectate lyase 18	73.100%	Swiss-Prot	Medium
`Q9LTZ0`	Arabidopsis thaliana	sp\|Q9LTZ0\|PLY11_ARATH Putative pectate lyase 11	71.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card