TkA07G136480 | RubberDandelionOmics

Gene overview

TkA07G136480

Reference: TK1151 Chr: Chr07 Coordinates: 35355871-35356570 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

444 bp · TkA07G136480|TK1151|cDNA

ATGTCATGTTTATTTCCCTTTTTACCCCTTATCAGTTTAGCTCGACAATGTGCCCTTCTGTGGTCGAATACAAGAGAGTCACTTGGATACCCATTAGGTGTTGTTTCTCAAGCTAACAACCTTGTTGTTCCACAAGAGGTTCTAGAATTAGAAGCCAAAAAGGTGTCTGAAGAACCGAAATTGTTTATTCTTGAGATTGGGACAGAAGAGTTTCCACCAAATGATGTTGCAAGTGCAGGCCAACAACTTAAAGATCTAAT...

CDS

Download CDS FASTA

444 bp · TkA07G136480|TK1151|CDS

ATGTCATGTTTATTTCCCTTTTTACCCCTTATCAGTTTAGCTCGACAATGTGCCCTTCTGTGGTCGAATACAAGAGAGTCACTTGGATACCCATTAGGTGTTGTTTCTCAAGCTAACAACCTTGTTGTTCCACAAGAGGTTCTAGAATTAGAAGCCAAAAAGGTGTCTGAAGAACCGAAATTGTTTATTCTTGAGATTGGGACAGAAGAGTTTCCACCAAATGATGTTGCAAGTGCAGGCCAACAACTTAAAGATCTAAT...

Protein

Download Protein FASTA

147 aa · TkA07G136480|TK1151|PROTEIN

MSCLFPFLPLISLARQCALLWSNTRESLGYPLGVVSQANNLVVPQEVLELEAKKVSEEPKLFILEIGTEEFPPNDVASAGQQLKDLIVQLLGRQMLTHGEVLVFGTPRRLVISVENLCSKQVANEVKVRGPPVAKAFDSQGNPTKVC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G136480`
TK1151 ID	TkA07G136480
OH-1004 ID	LXL04_010555
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.000
Protein coverage (%)	TK1151 91.156 / OH-1004 14.455 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G136480

Location Chr07:35355871-35356570 (+)

Description Similar to EDD1: Glycine--tRNA ligase, chloroplastic/mitochondrial 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48110`	Catalyzes the attachment of glycine to tRNA(Gly).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010555 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006420 arginyl-tRNA aminoacylation Biological Process

GO:0006426 glycyl-tRNA aminoacylation Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004814 arginine-tRNA ligase activity Molecular Function

GO:0004820 glycine-tRNA ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

ath:AT3G48110

cmu:TC_0178

cpa:CP_0913

cpj:glyQ

cpn:CPn_0946

cpt:CpB0981

ctb:CTL0165

ctr:CT_796

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.475

Rank 1 · TkA07G136480 · TK1151

Cytoplasm0.276

Rank 2 · TkA07G136480 · TK1151

Mitochondrion0.245

Rank 3 · TkA07G136480 · TK1151

Peroxisome0.112

Rank 4 · TkA07G136480 · TK1151

Nucleus0.088

Rank 5 · TkA07G136480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657Lipase_GDSL42-92 aa

PF02092tRNA_synt_2f62-146 aa

PF30585DUF865088-129 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G136480	`PF00657`	Lipase_GDSL	42	92	0.082	13.8
TkA07G136480	`PF02092`	tRNA_synt_2f	62	146	7.3e-22	78.7
TkA07G136480	`PF30585`	DUF8650	88	129	0.21	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L785`	Arabidopsis thaliana	sp\|Q8L785\|SYGM2_ARATH Glycine--tRNA ligase, chloroplastic/mitochondrial 2	59.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card