LXL04_010555 | RubberDandelionOmics

Gene overview

LXL04_010555

Reference: OH-1004 Chr: Chr02 Coordinates: 148994112-148999951 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2784 bp · LXL04_010555|LXL04_010555|OH1004|cDNA

ATGGGGATACTAACACTGCCACTGGTGACCTCCCTTCTCAGACCCCATCAACCCAAAATTTCTCTTCTATTCACCACCACTATCCACCACCATCACCGCCGTGCCGTCTTCCACCACCTCCCTATACGAACCCGTTTCAGCAGCGCCACCATCCCTCTCTGTTCTTTCACAAATTCCGCCGCTACCCAACATGATCAGTCTTCATTATCGGCGGAAGATTCAAATTCAAATGCAGATGAACGGCCAATTAAAGCTTCTAT...

CDS

Download CDS FASTA

2784 bp · LXL04_010555|LXL04_010555|OH1004|CDS

ATGGGGATACTAACACTGCCACTGGTGACCTCCCTTCTCAGACCCCATCAACCCAAAATTTCTCTTCTATTCACCACCACTATCCACCACCATCACCGCCGTGCCGTCTTCCACCACCTCCCTATACGAACCCGTTTCAGCAGCGCCACCATCCCTCTCTGTTCTTTCACAAATTCCGCCGCTACCCAACATGATCAGTCTTCATTATCGGCGGAAGATTCAAATTCAAATGCAGATGAACGGCCAATTAAAGCTTCTAT...

Protein

Download Protein FASTA

927 aa · LXL04_010555|LXL04_010555|OH1004|PROTEIN

MGILTLPLVTSLLRPHQPKISLLFTTTIHHHHRRAVFHHLPIRTRFSSATIPLCSFTNSAATQHDQSSLSAEDSNSNADERPIKASIPTFQQAIQRLQEYWASVGCTIMQCSNTEVGAGTMNPLTFLRVLGPEPWNVAYAEPSIRPDDSRYGENPNRLQRHTQFQVILKPDPGNSQDLFIRSLSALGCIDVNEHDIRFVEDNWESPVLGAWGLGWEIWMDGMEITQFTYFQQSGSLQLTPVSVEITYGLERILMLLQGVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010555`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010555

Location Chr02:148994112-148999951 (+)

Description Similar to EDD1: Glycine--tRNA ligase, chloroplastic/mitochondrial 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48110`	Catalyzes the attachment of glycine to tRNA(Gly).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010555 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006420 arginyl-tRNA aminoacylation Biological Process

GO:0006426 glycyl-tRNA aminoacylation Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004814 arginine-tRNA ligase activity Molecular Function

GO:0004820 glycine-tRNA ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

ath:AT3G48110

cmu:TC_0178

cpa:CP_0913

cpj:glyQ

cpn:CPn_0946

cpt:CpB0981

ctb:CTL0165

ctr:CT_796

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.960

Rank 1 · LXL04_010555 · OH-1004

Mitochondrion0.079

Rank 2 · LXL04_010555 · OH-1004

Cytoplasm0.058

Rank 3 · LXL04_010555 · OH-1004

Peroxisome0.033

Rank 4 · LXL04_010555 · OH-1004

Nucleus0.022

Rank 5 · LXL04_010555 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02091.21tRNA-synt_2e90-368 aa

PF02092.23tRNA_synt_2f404-908 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010555	`PF02091.21`	tRNA-synt_2e	90	368	5.2e-129	430.1
LXL04_010555	`PF02092.23`	tRNA_synt_2f	404	908	1.4e-172	576.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L785`	Arabidopsis thaliana	Glycine--tRNA ligase, chloroplastic/mitochondrial 2	70.334%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card