TkA07G106960 | RubberDandelionOmics

Gene overview

TkA07G106960

Reference: TK1151 Chr: Chr07 Coordinates: 27768186-27774531 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4042 bp · TkA07G106960|TK1151|cDNA

ATTCTTTGCACATCTTTCCACATATGTACCACCCAAAAACCCTCTCTCTATATATATAAACATATATATCATCTACAATTATTTAAACCATACTTCCACTTCTTCTGAAAAACTCATCGGAAAGATGAGTTCTCCGACCCAGTCGCCGGAGAAATCCATGGATGAAGAGAGTAAAAAGAAGAAGAAAAAGTCGATAATGATAATTTTCCGGTATGCAGATTGGTATGACAAATTGTTGATAGTTTTGGGCACACTTGGAG...

CDS

Download CDS FASTA

2067 bp · TkA07G106960|TK1151|CDS

ATGGGAAGAACAACGATGGTGGTTGCTCACAAGCTTGCAACGATACGAAACGCAGATGTGATTGCAGTTATGAGTGAAGGTACAGTTATCGAACAAGGCTCACACAGCGAATTAATCAATAATCACACCGGTCAGTACGCCCATTTAGTCAAACTTCAACGTCAATTCAGCTCGTTTAACGACGAACAGTACACTCCAGTAGCGAAAAGCAGCGCTTCGAGGTTAAGCACTTCGAAATCAAGCCCTGCAATGTTTGATTC...

Protein

Download Protein FASTA

688 aa · TkA07G106960|TK1151|PROTEIN

MGRTTMVVAHKLATIRNADVIAVMSEGTVIEQGSHSELINNHTGQYAHLVKLQRQFSSFNDEQYTPVAKSSASRLSTSKSSPAMFDSPIPLNDPQSLLSLNHPPPSFSRLLALNSPEWKQALIGSLAAAAFGAVQPVYALTVGGMISAFFVPNHEEMNSRIRTYSIIFCSLSIISILVNLLQHYNFAYMGEQLTKRIRLKMLEKILTFETAWFDDEQNASGVLCSRLSNEASMVKSLVADRMSLLIQTGSGVLIAMVMGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G106960`
TK1151 ID	TkA07G106960
OH-1004 ID	LXL04_027935
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 55.529 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G106960

Location Chr07:27768186-27774531 (+)

Description Similar to ABCB8: Putative ABC transporter B family member 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g30875`	Putative ABC transporter B family member 8.	No verified direct reference in this release
`At3g28345`	ABC transporter B family member 15.	No verified direct reference in this release
`At3g28390`	ABC transporter B family member 18.	No verified direct reference in this release
`At3g28380`	ABC transporter B family member 17.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0190300`	Putative multidrug resistance protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027935 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0055085 transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0042626 ATPase-coupled transmembrane transporter activity Molecular Function

GO:0140359 ABC-type transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G28345

ath:AT3G28390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.312

Rank 1 · TkA07G106960 · TK1151

Lysosome / Vacuole0.213

Rank 2 · TkA07G106960 · TK1151

Cytoplasm0.190

Rank 3 · TkA07G106960 · TK1151

Endoplasmic reticulum0.168

Rank 4 · TkA07G106960 · TK1151

Golgi apparatus0.093

Rank 5 · TkA07G106960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02463SMC_N30-658 aa

PF00664ABC_membrane124-392 aa

PF11990DUF3487222-272 aa

PF00005ABC_tran468-616 aa

PF07693KAP_NTPase474-523 aa

PF13191AAA_16478-632 aa

PF13401AAA_22479-625 aa

PF13555AAA_29479-495 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G106960	`PF02463`	SMC_N	30	658	2e-05	24.8
TkA07G106960	`PF00664`	ABC_membrane	124	392	1.1e-47	163.7
TkA07G106960	`PF11990`	DUF3487	222	272	0.17	12.4
TkA07G106960	`PF00005`	ABC_tran	468	616	1.1e-28	101.3
TkA07G106960	`PF07693`	KAP_NTPase	474	523	0.028	14.3
TkA07G106960	`PF13191`	AAA_16	478	632	0.024	15.8
TkA07G106960	`PF13401`	AAA_22	479	625	0.0017	19.3
TkA07G106960	`PF13555`	AAA_29	479	495	0.19	12.2
TkA07G106960	`PF00485`	PRK	480	514	0.1	13.1
TkA07G106960	`PF06414`	Zeta_toxin	482	517	0.11	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHK4`	Arabidopsis thaliana	sp\|Q9LHK4\|AB8B_ARATH Putative ABC transporter B family member 8	60.900%	Swiss-Prot	High
`Q9LHD1`	Arabidopsis thaliana	sp\|Q9LHD1\|AB15B_ARATH ABC transporter B family member 15	52.800%	Swiss-Prot	High
`Q9LSJ5`	Arabidopsis thaliana	sp\|Q9LSJ5\|AB18B_ARATH ABC transporter B family member 18	50.600%	Swiss-Prot	High
`Q9LSJ6`	Arabidopsis thaliana	sp\|Q9LSJ6\|AB17B_ARATH ABC transporter B family member 17	49.600%	Swiss-Prot	Medium
`Q6YUU5`	Oryza sativa subsp. japonica	sp\|Q6YUU5\|MDR_ORYSJ Putative multidrug resistance protein	54.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card