LXL04_027935 | RubberDandelionOmics

Gene overview

LXL04_027935

Reference: OH-1004 Chr: Chr06 Coordinates: 27111385-27117414 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3720 bp · LXL04_027935|LXL04_027935|OH1004|cDNA

ATGAGTTCTCCGACCCAGTCGCCGGAGAAATCCATGGATGAAGAGAgtaaaaagaagaagaaaaagtcGATAATGATAATTTTCCGGTATGCAGATTGGTATGACAAATTGTTGATAGTTTTGGGCACACTTGGAGCAATTGGAGATGGGATGTCTACAAATGTTTTATTGGTTTTTGTTAGTCGCCTTTTTAATCATTTGGGTTATGGAAAAGGtgttcaacaaaacccagaaAATTTTATGCACGAAATTGAAAAGTG...

CDS

Download CDS FASTA

3720 bp · LXL04_027935|LXL04_027935|OH1004|CDS

ATGAGTTCTCCGACCCAGTCGCCGGAGAAATCCATGGATGAAGAGAGTAAAAAGAAGAAGAAAAAGTCGATAATGATAATTTTCCGGTATGCAGATTGGTATGACAAATTGTTGATAGTTTTGGGCACACTTGGAGCAATTGGAGATGGGATGTCTACAAATGTTTTATTGGTTTTTGTTAGTCGCCTTTTTAATCATTTGGGTTATGGAAAAGGTGTTCAACAAAACCCAGAAAATTTTATGCACGAAATTGAAAAGTG...

Protein

Download Protein FASTA

1239 aa · LXL04_027935|LXL04_027935|OH1004|PROTEIN

MSSPTQSPEKSMDEESKKKKKKSIMIIFRYADWYDKLLIVLGTLGAIGDGMSTNVLLVFVSRLFNHLGYGKGVQQNPENFMHEIEKCSLAFVYIGLGVMVMAFMEGYCWSKISERQVLKIRYKYLEAILRQEVGFFDSQEATTSEIINSISKDTSLLQEVLSEKVPKFLMYSSMFLSGLAFCTYFSWRMALVAFPTTIFLIIPGLIYGKYLLFLSKKSFQEYSKANSIVEQALASIKTVYSFTAEKMIVKKYSMILDRTT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027935`
TK1151 ID	TkA07G106960
OH-1004 ID	LXL04_027935
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 55.529 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027935

Location Chr06:27111385-27117414 (+)

Description Similar to ABCB8: Putative ABC transporter B family member 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g30875`	Putative ABC transporter B family member 8.	No verified direct reference in this release
`At3g28345`	ABC transporter B family member 15.	No verified direct reference in this release
`At3g28390`	ABC transporter B family member 18.	No verified direct reference in this release
`At3g28380`	ABC transporter B family member 17.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0190300`	Putative multidrug resistance protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027935 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0055085 transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0042626 ATPase-coupled transmembrane transporter activity Molecular Function

GO:0140359 ABC-type transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G28345

ath:AT3G28390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.530

Rank 1 · LXL04_027935 · OH-1004

Lysosome / Vacuole0.182

Rank 2 · LXL04_027935 · OH-1004

Endoplasmic reticulum0.144

Rank 3 · LXL04_027935 · OH-1004

Cytoplasm0.131

Rank 4 · LXL04_027935 · OH-1004

Golgi apparatus0.063

Rank 5 · LXL04_027935 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00664.29ABC_membrane42-311 aa

PF00005.34ABC_tran384-533 aa

PF02463.26SMC_N417-575 aa

PF00664.29ABC_membrane675-943 aa

PF02463.26SMC_N776-1209 aa

PF00005.34ABC_tran1019-1167 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027935	`PF00664.29`	ABC_membrane	42	311	2.9e-93	313.2
LXL04_027935	`PF00005.34`	ABC_tran	384	533	8.9e-63	211.7
LXL04_027935	`PF02463.26`	SMC_N	417	575	1.3e-12	48.4
LXL04_027935	`PF00664.29`	ABC_membrane	675	943	2.9e-93	313.2
LXL04_027935	`PF02463.26`	SMC_N	776	1209	1.3e-12	48.4
LXL04_027935	`PF00005.34`	ABC_tran	1019	1167	8.9e-63	211.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHK4`	Arabidopsis thaliana	Putative ABC transporter B family member 8	63.205%	Swiss-Prot	strong database homology
`Q9LHD1`	Arabidopsis thaliana	ABC transporter B family member 15	51.882%	Swiss-Prot	strong database homology
`Q9LSJ5`	Arabidopsis thaliana	ABC transporter B family member 18	50.896%	Swiss-Prot	strong database homology
`Q9LSJ6`	Arabidopsis thaliana	ABC transporter B family member 17	49.960%	Swiss-Prot	moderate database homology
`Q6YUU5`	Oryza sativa subsp. japonica	Putative multidrug resistance protein	54.967%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card