RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G002890
Reference: TK1151 Chr: Chr07 Coordinates: 780027-783839 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2302 bp · TkA07G002890|TK1151|cDNA

AGAGATATCTAAATATAGAAAGAATGAAGATGATCAAAGGGTTTGCAATGGCGGTGTTTGTAGGGTACCTTTTCCTATGGGTGATAACTCCAACCTACGTCTTCAAGCAAAAGTGGCTCGTTAGGGTTCGAGCCCACACTGCTTCTACTTACTTTGGAACTCAAGGTCCATCGATGTTACTCTATACATTTCCTATTCTCTTGATGGCTGTTGCCGGGAGTATATATCTCCATTTGAAGAAAAAGTCGAACCAAAACCGG...

CDS

Download CDS FASTA

2097 bp · TkA07G002890|TK1151|CDS

ATGAAGATGATCAAAGGGTTTGCAATGGCGGTGTTTGTAGGGTACCTTTTCCTATGGGTGATAACTCCAACCTACGTCTTCAAGCAAAAGTGGCTCGTTAGGGTTCGAGCCCACACTGCTTCTACTTACTTTGGAACTCAAGGTCCATCGATGTTACTCTATACATTTCCTATTCTCTTGATGGCTGTTGCCGGGAGTATATATCTCCATTTGAAGAAAAAGTCGAACCAAAACCGGGATCAAGGGCAAAAAGAAGCCAC...

Protein

Download Protein FASTA

698 aa · TkA07G002890|TK1151|PROTEIN

MKMIKGFAMAVFVGYLFLWVITPTYVFKQKWLVRVRAHTASTYFGTQGPSMLLYTFPILLMAVAGSIYLHLKKKSNQNRDQGQKEATNDNLTIWRRPMIVKTLGIVTKIELAFFIMFIALLTWSFTEYLHLSLAKVTPQSAALYGEKIWEAKLATVGLQFGLIGNICLAFMFYPVTRGSSLLPLFGLTSEASVKYHIWLGHIVMTLFTSHGVCYIICWIATKQTSEMLNWAKTDISVVAGEVTLVAGLVMWATTFPKIRR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G002890
TK1151 IDTkA07G002890
OH-1004 IDLXL04_026707
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.600
Protein coverage (%)TK1151 99.713 / OH-1004 89.345
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G002890
LocationChr07:780027-783839 (+)
DescriptionSimilar to FRO2: Ferric reduction oxidase 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g01580 Flavocytochrome that transfers electrons across the plasma membrane to reduce ferric iron chelates to form soluble ferrous iron in the rhizosphere.
A ferric-chelate reductase for iron uptake from soils.1999 · DOI: 10.1038/17800
Overexpression of the FRO2 ferric chelate reductase confers tolerance to growth on low iron and uncovers posttranscriptional control.2003 · DOI: 10.1104/pp.103.025122
Molecular and biochemical characterization of the Fe(III) chelate reductase gene family in Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci163
The FRO2 ferric reductase is required for glycine betaine's effect on chilling tolerance in Arabidopsis roots.2008 · DOI: 10.1111/j.1399-3054.2008.01141.x
At1g23020 Ferric chelate reductase involved in iron reduction in roots.
Molecular and biochemical characterization of the Fe(III) chelate reductase gene family in Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci163
At1g01590 Ferric chelate reductase involved in iron reduction in roots (By similarity). No verified direct reference in this release
At5g23980 Ferric chelate reductase.
Molecular and biochemical characterization of the Fe(III) chelate reductase gene family in Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci163
Transcriptome sequencing identifies SPL7-regulated copper acquisition genes FRO4/FRO5 and the copper dependence of iron homeostasis in Arabidopsis.2012 · DOI: 10.1105/tpc.111.090431
At5g23990 Ferric chelate reductase probably involved in iron reduction in shoots.
Molecular and biochemical characterization of the Fe(III) chelate reductase gene family in Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci163
Transcriptome sequencing identifies SPL7-regulated copper acquisition genes FRO4/FRO5 and the copper dependence of iron homeostasis in Arabidopsis.2012 · DOI: 10.1105/tpc.111.090431

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_026707 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009617 response to bacterium Biological Process
GO:0033212 iron import into cell Biological Process
GO:0033214 siderophore-iron import into cell Biological Process
GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process
GO:0005634 nucleus Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0031966 mitochondrial membrane Cellular Component
GO:0000293 ferric-chelate reductase activity Molecular Function
GO:0046872 metal ion binding Molecular Function
GO:0140618 ferric-chelate reductase (NADH) activity Molecular Function
KEGG gene cross-reference
ath:AT1G01580
ath:AT1G01590
ath:AT1G23020
ath:AT5G23980
ath:AT5G23990
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.588
Rank 1 · TkA07G002890 · TK1151
Endoplasmic reticulum0.152
Rank 2 · TkA07G002890 · TK1151
Lysosome / Vacuole0.132
Rank 3 · TkA07G002890 · TK1151
Cytoplasm0.080
Rank 4 · TkA07G002890 · TK1151
Golgi apparatus0.068
Rank 5 · TkA07G002890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17870Insulin_TMD16-30 aa
PF10066DUF230447-79 aa
PF17870Insulin_TMD56-74 aa
PF08030NAD_binding_667-95 aa
PF10066DUF2304101-132 aa
PF01794Ferric_reduct160-281 aa
PF10066DUF2304243-288 aa
PF17870Insulin_TMD274-288 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G002890PF17870Insulin_TMD16301.010.2
TkA07G002890PF10066DUF230447791.59.8
TkA07G002890PF17870Insulin_TMD56741.010.2
TkA07G002890PF08030NAD_binding_667951.1e-2384.7
TkA07G002890PF10066DUF23041011321.59.8
TkA07G002890PF01794Ferric_reduct1602813.7e-2072.9
TkA07G002890PF10066DUF23042432881.59.8
TkA07G002890PF17870Insulin_TMD2742881.010.2
TkA07G002890PF08022FAD_binding_83144108.1e-2587.7
TkA07G002890PF00970FAD_binding_63303980.2312.6
TkA07G002890PF08030NAD_binding_64196821.1e-2384.7
TkA07G002890PF00175NAD_binding_14234700.0001523.1
TkA07G002890PF01794Ferric_reduct5275683.7e-2072.9
TkA07G002890PF17870Insulin_TMD5405491.010.2
TkA07G002890PF00175NAD_binding_16546760.0001523.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
P92949Arabidopsis thalianasp|P92949|FRO2_ARATH Ferric reduction oxidase 256.200%Swiss-ProtHigh
F4I4K7Arabidopsis thalianasp|F4I4K7|FRO3_ARATH Ferric reduction oxidase 3, mitochondrial54.000%Swiss-ProtHigh
Q9LMM2Arabidopsis thalianasp|Q9LMM2|FRO1_ARATH Probable ferric reduction oxidase 153.200%Swiss-ProtHigh
Q8W110Arabidopsis thalianasp|Q8W110|FRO4_ARATH Ferric reduction oxidase 447.200%Swiss-ProtMedium
Q9FLW2Arabidopsis thalianasp|Q9FLW2|FRO5_ARATH Ferric reduction oxidase 546.600%Swiss-ProtMedium

JBrowse

View in Genome Browser