TkA06G285260 | RubberDandelionOmics

Gene overview

TkA06G285260

Reference: TK1151 Chr: Chr06 Coordinates: 71947737-71948724 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

423 bp · TkA06G285260|TK1151|cDNA

TTACTTCTCACCTACTTGACCCGTGAAGCAGAGGAAATCCAAAAAATATTGGTCTTTGAGGGTGCTTTTGAAAAGATTTTCAGTATCATCAAAGAAGAAGGAGGTTCAGAAGGTGGTGTTGTCCAGGACTGTCTTGAACTGTTAAACAATCTCCTTCGAAACAATGCATCCAATCAGGTGTTGCTGAGGGAGACTATAGGGTTTGACTCCATAATATCAATCTTGAAGCTAAGAGGAACCACATACAGCTTTACTCAACA...

CDS

Download CDS FASTA

423 bp · TkA06G285260|TK1151|CDS

TTACTTCTCACCTACTTGACCCGTGAAGCAGAGGAAATCCAAAAAATATTGGTCTTTGAGGGTGCTTTTGAAAAGATTTTCAGTATCATCAAAGAAGAAGGAGGTTCAGAAGGTGGTGTTGTCCAGGACTGTCTTGAACTGTTAAACAATCTCCTTCGAAACAATGCATCCAATCAGGTGTTGCTGAGGGAGACTATAGGGTTTGACTCCATAATATCAATCTTGAAGCTAAGAGGAACCACATACAGCTTTACTCAACA...

Protein

Download Protein FASTA

141 aa · TkA06G285260|TK1151|PROTEIN

LLLTYLTREAEEIQKILVFEGAFEKIFSIIKEEGGSEGGVVQDCLELLNNLLRNNASNQVLLRETIGFDSIISILKLRGTTYSFTQQKTINLLIGLETSSLLLSGGLETDPTTNNNRITILTKQFLFSVLDHLLMLGVESQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G285260`
TK1151 ID	TkA06G285260
OH-1004 ID	LXL04_026412
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.000
Protein coverage (%)	TK1151 100.000 / OH-1004 15.203 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G285260

Location Chr06:71947737-71948724 (+)

Description Similar to GC6: Golgin candidate 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g27530`	Golgi matrix protein playing a role in tethering of vesicles to Golgi membranes and in maintaining the overall structure of the Golgi apparatus.	MAG4/Atp115 is a golgi-localized tethering factor that mediates efficient anterograde transport in Arabidopsis.2010 · DOI: 10.1093/pcp/pcq137

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026412 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0006891 intra-Golgi vesicle-mediated transport Biological Process

GO:0007030 Golgi organization Biological Process

GO:0007264 small GTPase-mediated signal transduction Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0032252 secretory granule localization Biological Process

GO:0032527 protein exit from endoplasmic reticulum Biological Process

GO:0045056 transcytosis Biological Process

GO:0048211 Golgi vesicle docking Biological Process

GO:0048219 inter-Golgi cisterna vesicle-mediated transport Biological Process

GO:0048280 vesicle fusion with Golgi apparatus Biological Process

KEGG gene cross-reference

ath:AT3G27530

bta:317724

hsa:8615

mmu:56041

rno:56042

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.417

Rank 1 · TkA06G285260 · TK1151

Nucleus0.361

Rank 2 · TkA06G285260 · TK1151

Endoplasmic reticulum0.147

Rank 3 · TkA06G285260 · TK1151

Golgi apparatus0.112

Rank 4 · TkA06G285260 · TK1151

Lysosome / Vacuole0.068

Rank 5 · TkA06G285260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11841ELMO_ARM24-96 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G285260	`PF11841`	ELMO_ARM	24	96	0.00014	22.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B0F9L4`	Arabidopsis thaliana	sp\|B0F9L4\|GOGC6_ARATH Golgin candidate 6	59.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card