TkA06G247920 | RubberDandelionOmics

Gene overview

TkA06G247920

Reference: TK1151 Chr: Chr06 Coordinates: 63346930-63347358 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

429 bp · TkA06G247920|TK1151|cDNA

ATGCCTGGATTGACATTCTCGAACGAATTGATCTCGCGAGACGAAGGATTACATTGTGATTTCGCTTGTTTGCTTTACGGGTTACTGAAGACGAAGTTGAGTGAGGAGCGAGTCAAGGGAATCATCTCTGATGCGGTGGCGATTGAACGAGAATTCGTCTGCGATGCCTTACCTTGCGCTCTTGTAGGGATGAACGGTGATCTCATGAGTGAATACATCGAATTCGTTGCCGATAGATTATTAGGCGCATTAGGTTACGG...

CDS

Download CDS FASTA

429 bp · TkA06G247920|TK1151|CDS

ATGCCTGGATTGACATTCTCGAACGAATTGATCTCGCGAGACGAAGGATTACATTGTGATTTCGCTTGTTTGCTTTACGGGTTACTGAAGACGAAGTTGAGTGAGGAGCGAGTCAAGGGAATCATCTCTGATGCGGTGGCGATTGAACGAGAATTCGTCTGCGATGCCTTACCTTGCGCTCTTGTAGGGATGAACGGTGATCTCATGAGTGAATACATCGAATTCGTTGCCGATAGATTATTAGGCGCATTAGGTTACGG...

Protein

Download Protein FASTA

142 aa · TkA06G247920|TK1151|PROTEIN

MPGLTFSNELISRDEGLHCDFACLLYGLLKTKLSEERVKGIISDAVAIEREFVCDALPCALVGMNGDLMSEYIEFVADRLLGALGYGKLYNAQNPFDWMELISLQGKTNFFEKRVGEYQKASVMSNLNGNGDSHVFKMDEDF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G247920`
TK1151 ID	TkA06G247920
OH-1004 ID	LXL04_023827
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 43.161 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G247920

Location Chr06:63346930-63347358 (-)

Description Similar to Ribonucleoside-diphosphate reductase small chain

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g27060`	Provides the precursors necessary for DNA synthesis.	Arabidopsis ribonucleotide reductases are critical for cell cycle progression, DNA damage repair, and plant development.2006 · DOI: 10.1105/tpc.105.037044
`UniProt: P0DKH3`	Provides the precursors necessary for DNA synthesis.	No verified direct reference in this release
`At3g23580`	Provides the precursors necessary for DNA synthesis.	Arabidopsis ribonucleotide reductases are critical for cell cycle progression, DNA damage repair, and plant development.2006 · DOI: 10.1105/tpc.105.037044

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023827 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0009259 ribonucleotide metabolic process Biological Process

GO:0009263 deoxyribonucleotide biosynthetic process Biological Process

GO:0012501 programmed cell death Biological Process

GO:0051726 regulation of cell cycle Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005971 ribonucleoside-diphosphate reductase complex Cellular Component

GO:0004748 ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G23580

ath:AT3G27060

nta:107781035

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.681

Rank 1 · TkA06G247920 · TK1151

Nucleus0.546

Rank 2 · TkA06G247920 · TK1151

Mitochondrion0.062

Rank 3 · TkA06G247920 · TK1151

Cell membrane0.054

Rank 4 · TkA06G247920 · TK1151

Endoplasmic reticulum0.051

Rank 5 · TkA06G247920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00268Ribonuc_red_sm1-95 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G247920	`PF00268`	Ribonuc_red_sm	1	95	8.9e-32	111.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSD0`	Arabidopsis thaliana	sp\|Q9LSD0\|RIR2C_ARATH Ribonucleoside-diphosphate reductase small chain C	86.800%	Swiss-Prot	High
`P0DKH3`	Arabidopsis thaliana	sp\|P0DKH3\|RI2BL_ARATH Ribonucleoside-diphosphate reductase small chain B	79.300%	Swiss-Prot	High
`P50651`	Arabidopsis thaliana	sp\|P50651\|RIR2A_ARATH Ribonucleoside-diphosphate reductase small chain A	71.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card