TkA06G072040 | RubberDandelionOmics

Gene overview

TkA06G072040

Reference: TK1151 Chr: Chr06 Coordinates: 19295334-19297680 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1290 bp · TkA06G072040|TK1151|cDNA

TGAATGTTTTATTCTCAATAGACAATGAAGCTGACCTAACTTATCTTTTTATCTCCTCAATACTTTCTCCTATATATACATTAACAACTTTCGACGAGATTGTACCAACCAAAACCTACGGAGATGGAGAAAGCTTATGAAGGCCATGTGTTGGTGTTGCCTTACCCAAGCCAAGGCCATATTAACCCTCTCCTTCAATTTGCCAAAAGACTCGTCTCCAAAGGACTTAAAGCCACCATCGCCACCACCCACTACACCCT...

CDS

Download CDS FASTA

1167 bp · TkA06G072040|TK1151|CDS

ATGGAGAAAGCTTATGAAGGCCATGTGTTGGTGTTGCCTTACCCAAGCCAAGGCCATATTAACCCTCTCCTTCAATTTGCCAAAAGACTCGTCTCCAAAGGACTTAAAGCCACCATCGCCACCACCCACTACACCCTTTCTTCCATCTCCGCCCCATTCATCACCGTGGAGCCCATCTCCGACGGCTTTGACCATGGTGGTTTCGCTCAAGCCCAATCAGCGGATGTCTTTCTAGAATCCTTTAAGTCCAATGGCTCACG...

Protein

Download Protein FASTA

388 aa · TkA06G072040|TK1151|PROTEIN

MEKAYEGHVLVLPYPSQGHINPLLQFAKRLVSKGLKATIATTHYTLSSISAPFITVEPISDGFDHGGFAQAQSADVFLESFKSNGSRTLTQLIKKHQTTKNPITCVVYDSFFPWALEVAKENGILGAPFFTNSAAVSSIFSRIHGGMLRVPVRLDDCPVVLPGVPPLNLEDLPSFLNAPESYPAYLKMKLNQFSNLEKADWIFCNSFRSLEPEVVKGIGEQWSAKLIGPMVPSAYLDGRIEGDKGYGASLWKPVNHECTK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G072040`
TK1151 ID	TkA06G072040
OH-1004 ID	LXL04_025246
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	84.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G072040

Location Chr06:19295334-19297680 (-)

Description Similar to UGT74B1: UDP-glycosyltransferase 74B1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g24100`	Involved in the biosynthesis of glucosinolate.	Arabidopsis glucosyltransferase UGT74B1 functions in glucosinolate biosynthesis and auxin homeostasis.2004 · DOI: 10.1111/j.1365-313x.2004.02261.x
`At2g43820`	Glycosyltransferase that glucosylates benzoic acid and derivatives.	Glucose conjugation of anthranilate by the Arabidopsis UGT74F2 glucosyltransferase is required for tryptophan mutant blue fluorescence.2003 · DOI: 10.1074/jbc.m211822200
`At2g43840`	Possesses quercetin 7-O-glucosyltransferase and 4'-O- glucosyltransferase activities in vitro.	Glucose conjugation of anthranilate by the Arabidopsis UGT74F2 glucosyltransferase is required for tryptophan mutant blue fluorescence.2003 · DOI: 10.1074/jbc.m211822200
`At1g05680`	Glucosyltransferase that acts on the auxin indole-3-butyric acid (IBA).	Perturbation of indole-3-butyric acid homeostasis by the UDP-glucosyltransferase UGT74E2 modulates Arabidopsis architecture and water stress tolerance.2010 · DOI: 10.1105/tpc.109.071316

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025246 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009696 salicylic acid metabolic process Biological Process

GO:0010016 shoot system morphogenesis Biological Process

GO:0010030 positive regulation of seed germination Biological Process

GO:0018874 benzoate metabolic process Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0046482 para-aminobenzoic acid metabolic process Biological Process

GO:0052544 defense response by callose deposition in cell wall Biological Process

GO:0070301 cellular response to hydrogen peroxide Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

GO:0071475 cellular hyperosmotic salinity response Biological Process

KEGG gene cross-reference

ag:AEM42999

ath:AT1G05680

ath:AT1G24100

ath:AT2G43820

ath:AT2G43840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.791

Rank 1 · TkA06G072040 · TK1151

Nucleus0.224

Rank 2 · TkA06G072040 · TK1151

Endoplasmic reticulum0.073

Rank 3 · TkA06G072040 · TK1151

Cell membrane0.049

Rank 4 · TkA06G072040 · TK1151

Peroxisome0.049

Rank 5 · TkA06G072040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201UDPGT9-139 aa

PF26168Glyco_transf_N9-42 aa

PF26168Glyco_transf_N79-146 aa

PF11227DUF3025230-312 aa

PF00201UDPGT248-290 aa

PF06910MEA1282-313 aa

PF00201UDPGT292-345 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G072040	`PF00201`	UDPGT	9	139	2.3e-06	27.4
TkA06G072040	`PF26168`	Glyco_transf_N	9	42	8.3e-06	26.6
TkA06G072040	`PF26168`	Glyco_transf_N	79	146	8.3e-06	26.6
TkA06G072040	`PF11227`	DUF3025	230	312	0.089	13.3
TkA06G072040	`PF00201`	UDPGT	248	290	2.3e-06	27.4
TkA06G072040	`PF06910`	MEA1	282	313	0.34	12.2
TkA06G072040	`PF00201`	UDPGT	292	345	2.3e-06	27.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48676`	Arabidopsis thaliana	sp\|O48676\|U74B1_ARATH UDP-glycosyltransferase 74B1	43.300%	Swiss-Prot	Medium
`O22822`	Arabidopsis thaliana	sp\|O22822\|U74F2_ARATH UDP-glycosyltransferase 74F2	41.600%	Swiss-Prot	Medium
`O22820`	Arabidopsis thaliana	sp\|O22820\|U74F1_ARATH Flavonol 7-O-beta-glucosyltransferase UGT74F1	40.300%	Swiss-Prot	Medium
`Q9SYK9`	Arabidopsis thaliana	sp\|Q9SYK9\|U74E2_ARATH UDP-glycosyltransferase 74E2	38.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card