LXL04_025246 | RubberDandelionOmics

Gene overview

LXL04_025246

Reference: OH-1004 Chr: Chr05 Coordinates: 108607280-108609506 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1374 bp · LXL04_025246|LXL04_025246|OH1004|cDNA

ATGGAGAAAGCTTATGAAGGCCATGTGTTGGTGTTGCCTTACCCAAGCCAAGGCCATATCAACCCTCTCCTTCAATTTGCCAAAAGACTCGTCTCCAAAGGACTTAAAGCCACCATCGCCACCACCCACTACACCCTTTCTTCCATCTCCGCCCCATTCATCACCGTGGAGCCCATCTCCGACGGCTTTGACCATGGTGGTTTCGCTCAAGCCCAATCAGCGGATGTCTTTCTAGAATCCTTTAAGTCCAATGGCTCACG...

CDS

Download CDS FASTA

1374 bp · LXL04_025246|LXL04_025246|OH1004|CDS

ATGGAGAAAGCTTATGAAGGCCATGTGTTGGTGTTGCCTTACCCAAGCCAAGGCCATATCAACCCTCTCCTTCAATTTGCCAAAAGACTCGTCTCCAAAGGACTTAAAGCCACCATCGCCACCACCCACTACACCCTTTCTTCCATCTCCGCCCCATTCATCACCGTGGAGCCCATCTCCGACGGCTTTGACCATGGTGGTTTCGCTCAAGCCCAATCAGCGGATGTCTTTCTAGAATCCTTTAAGTCCAATGGCTCACG...

Protein

Download Protein FASTA

457 aa · LXL04_025246|LXL04_025246|OH1004|PROTEIN

MEKAYEGHVLVLPYPSQGHINPLLQFAKRLVSKGLKATIATTHYTLSSISAPFITVEPISDGFDHGGFAQAQSADVFLESFKSNGSRTLTQLIKKHQTTKNPITCVVYDSFFPWALEVAKENGILGAPFFTNSAAVSSIFSRIHGGMLRVPVRLEDCPVVLPGVPPLNLEDLPSFLNAPESYPAYLKMKLNQFSNLEKADWIFCNSFRSLEPEVVKGIGEQWSAKLIGPMVPSAYLDGRIEGDKGYGASLWKPLNHECTK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025246`
TK1151 ID	TkA06G072040
OH-1004 ID	LXL04_025246
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	84.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025246

Location Chr05:108607280-108609506 (+)

Description Similar to UGT74B1: UDP-glycosyltransferase 74B1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g24100`	Involved in the biosynthesis of glucosinolate.	Arabidopsis glucosyltransferase UGT74B1 functions in glucosinolate biosynthesis and auxin homeostasis.2004 · DOI: 10.1111/j.1365-313x.2004.02261.x
`At2g43820`	Glycosyltransferase that glucosylates benzoic acid and derivatives.	Glucose conjugation of anthranilate by the Arabidopsis UGT74F2 glucosyltransferase is required for tryptophan mutant blue fluorescence.2003 · DOI: 10.1074/jbc.m211822200
`At2g43840`	Possesses quercetin 7-O-glucosyltransferase and 4'-O- glucosyltransferase activities in vitro.	Glucose conjugation of anthranilate by the Arabidopsis UGT74F2 glucosyltransferase is required for tryptophan mutant blue fluorescence.2003 · DOI: 10.1074/jbc.m211822200
`At1g05680`	Glucosyltransferase that acts on the auxin indole-3-butyric acid (IBA).	Perturbation of indole-3-butyric acid homeostasis by the UDP-glucosyltransferase UGT74E2 modulates Arabidopsis architecture and water stress tolerance.2010 · DOI: 10.1105/tpc.109.071316

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025246 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009696 salicylic acid metabolic process Biological Process

GO:0010016 shoot system morphogenesis Biological Process

GO:0010030 positive regulation of seed germination Biological Process

GO:0018874 benzoate metabolic process Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0046482 para-aminobenzoic acid metabolic process Biological Process

GO:0052544 defense response by callose deposition in cell wall Biological Process

GO:0070301 cellular response to hydrogen peroxide Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

GO:0071475 cellular hyperosmotic salinity response Biological Process

KEGG gene cross-reference

ag:AEM42999

ath:AT1G05680

ath:AT1G24100

ath:AT2G43820

ath:AT2G43840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.761

Rank 1 · LXL04_025246 · OH-1004

Nucleus0.214

Rank 2 · LXL04_025246 · OH-1004

Endoplasmic reticulum0.067

Rank 3 · LXL04_025246 · OH-1004

Peroxisome0.067

Rank 4 · LXL04_025246 · OH-1004

Plastid0.056

Rank 5 · LXL04_025246 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26168.1Glyco_transf_N9-42 aa

PF00201.25UDPGT248-413 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025246	`PF26168.1`	Glyco_transf_N	9	42	7.3e-06	26.8
LXL04_025246	`PF00201.25`	UDPGT	248	413	1.1e-28	101.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48676`	Arabidopsis thaliana	UDP-glycosyltransferase 74B1	53.626%	Swiss-Prot	strong database homology
`O22822`	Arabidopsis thaliana	UDP-glycosyltransferase 74F2	49.231%	Swiss-Prot	moderate database homology
`O22820`	Arabidopsis thaliana	Flavonol 7-O-beta-glucosyltransferase UGT74F1	48.156%	Swiss-Prot	moderate database homology
`Q9SYK9`	Arabidopsis thaliana	UDP-glycosyltransferase 74E2	48.000%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card