TkA06G046150 | RubberDandelionOmics

Gene overview

TkA06G046150

Reference: TK1151 Chr: Chr06 Coordinates: 12490553-12494097 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2765 bp · TkA06G046150|TK1151|cDNA

GGGGGTTGTTATTTGTGAATTGTGAACATGATCCTCGTGAATCCCAATTCGTGATGATGCGCCAACTTACTGAATTCCGAGTGGACCTATCTCTTCCTCTCAAAAGCGTCTCAAATTTCTTCGACTTCCTGACCTCAAGTTTTCATGGAAATTATTACAACCGGTAACTTCGATCCCACTTGTCTGCTCCCAAAGCTATCAAGGTTACGTTTTTCCTGAACTCTCTGCAACCGCCGTATCAAAATCTCGAAAACTAATCC...

CDS

Download CDS FASTA

2019 bp · TkA06G046150|TK1151|CDS

ATGACTTCTCAATCATCGTCTACAAGCTGTGAATTTCCACAGATTTTATGGGTGTCTTCATCGTCAATTTGCCCATGTAAGAGAAGTACAAAATCGAGTCTCTATAGTTCAAAAAAGTTCAATTGCTTCATTAGCAGGAAGAGGCTTTCCAAAAGAAGAAAATTTTCCCTAGTTTGGGCATGTGTGGTTCCCAATGATGGAACAAACCATAATTTAAACCTAGAGTTCGTGAATTCCACAAAACGGGGCGCTAAACGTTA...

Protein

Download Protein FASTA

672 aa · TkA06G046150|TK1151|PROTEIN

MTSQSSSTSCEFPQILWVSSSSICPCKRSTKSSLYSSKKFNCFISRKRLSKRRKFSLVWACVVPNDGTNHNLNLEFVNSTKRGAKRYVLKQISDDDSSSETSIPLHSSNSFTNFREDPIVDKLRTQLGVIHPIPSPPINRNIVGLFVFFFFVGVAFDKLWTSRKKNKSRDEATPGIWPQVPTSFSLFLEKDLQRKESVEWVNMVLGKLWKVYRGGLENWVIGLLQPVIDNLKKPDYVERVEIKQFSLGNEPLSVRNVERR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G046150`
TK1151 ID	TkA06G046150
OH-1004 ID	LXL04_025676
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G046150`
Location	Chr06:12490553-12494097 (-)
Description	Similar to SPAPYUK71.03c: Uncharacterized protein PYUK71.03c (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025676` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0035621 ER to Golgi ceramide transport Biological Process GO:0061817 endoplasmic reticulum-plasma membrane tethering Biological Process GO:0071476 cellular hypotonic response Biological Process GO:0090158 endoplasmic reticulum membrane organization Biological Process GO:0120009 intermembrane lipid transfer Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0031520 plasma membrane of cell tip Cellular Component GO:0140268 endoplasmic reticulum-plasma membrane contact site Cellular Component GO:0160219 cortical endoplasmic reticulum membrane Cellular Component
KEGG gene cross-reference	hsa:23344 mmu:23943 pon:100172662 rno:29579 spo:2542267 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.974

Rank 1 · TkA06G046150 · TK1151

Nucleus0.026

Rank 2 · TkA06G046150 · TK1151

Peroxisome0.026

Rank 3 · TkA06G046150 · TK1151

Cytoplasm0.026

Rank 4 · TkA06G046150 · TK1151

Golgi apparatus0.023

Rank 5 · TkA06G046150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26547PDZD8_N70-115 aa

PF10296MMM1191-266 aa

PF25669SMP_MUG190-like196-258 aa

PF26547PDZD8_N196-373 aa

PF25669SMP_MUG190-like282-382 aa

PF00168C2408-508 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G046150	`PF26547`	PDZD8_N	70	115	1.3e-05	25.7
TkA06G046150	`PF10296`	MMM1	191	266	0.014	15.5
TkA06G046150	`PF25669`	SMP_MUG190-like	196	258	1.1e-17	65.1
TkA06G046150	`PF26547`	PDZD8_N	196	373	1.3e-05	25.7
TkA06G046150	`PF25669`	SMP_MUG190-like	282	382	1.1e-17	65.1
TkA06G046150	`PF00168`	C2	408	508	2.2e-12	47.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card