Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2019 bp · LXL04_025676|LXL04_025676|OH1004|cDNA
ATGACTTCTCAATCATCGTCTACAAGCTGTGAATTTCCACAGATTTTATGGGTGTCTTCATCGTCAATTTGCCCATGTAAGAGAAGTACAAAATCGAGTCTCTATAGTTCAAAAAAGTTCAATTGCTTCATTAGCAGGAAGAGGCtttccaaaagaagaaaatttTCCCCAGTTTGGGCATGTGTGGTTCCCAATGATGGAACAAACCATAATTTAAACCTAGAGTTCGTGAATTCCACAAAACGGGGCGCTAAACGTTA...
2019 bp · LXL04_025676|LXL04_025676|OH1004|CDS
ATGACTTCTCAATCATCGTCTACAAGCTGTGAATTTCCACAGATTTTATGGGTGTCTTCATCGTCAATTTGCCCATGTAAGAGAAGTACAAAATCGAGTCTCTATAGTTCAAAAAAGTTCAATTGCTTCATTAGCAGGAAGAGGCTTTCCAAAAGAAGAAAATTTTCCCCAGTTTGGGCATGTGTGGTTCCCAATGATGGAACAAACCATAATTTAAACCTAGAGTTCGTGAATTCCACAAAACGGGGCGCTAAACGTTA...
Protein
Download Protein FASTA672 aa · LXL04_025676|LXL04_025676|OH1004|PROTEIN
MTSQSSSTSCEFPQILWVSSSSICPCKRSTKSSLYSSKKFNCFISRKRLSKRRKFSPVWACVVPNDGTNHNLNLEFVNSTKRGAKRYVLKQISDDDSSSETSIPLHSSNSFTNFREDPIVDKLRTQLGVIHPIPSPPINRNIVGLFVFFFFVGVAFDKLWTSRKKNKSRDEATPGIWPQVPTSFSLFLEKDLQRKESVEWVNMVLGKLWKVYRGGLENWVIGLLQPVIDNLKKPDYVERVEIKQFSLGNEPLSVRNVERR...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_025676 |
|---|---|
| TK1151 ID | TkA06G046150 |
| OH-1004 ID | LXL04_025676 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.900 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_025676 |
|---|---|
| Location | Chr05:115086170-115088856 (+) |
| Description | Similar to SPAPYUK71.03c: Uncharacterized protein PYUK71.03c (Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0035621 ER to Golgi ceramide transport Biological Process GO:0061817 endoplasmic reticulum-plasma membrane tethering Biological Process GO:0071476 cellular hypotonic response Biological Process GO:0090158 endoplasmic reticulum membrane organization Biological Process GO:0120009 intermembrane lipid transfer Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0031520 plasma membrane of cell tip Cellular Component GO:0140268 endoplasmic reticulum-plasma membrane contact site Cellular Component GO:0160219 cortical endoplasmic reticulum membrane Cellular Component |
| KEGG gene cross-reference | hsa:23344 mmu:23943 pon:100172662 rno:29579 spo:2542267 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF25669.2SMP_MUG190-like196-258 aaPF25669.2SMP_MUG190-like282-382 aaPF00168.37C2408-508 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_025676 | PF25669.2 | SMP_MUG190-like | 196 | 258 | 1.1e-17 | 65.1 |
| LXL04_025676 | PF25669.2 | SMP_MUG190-like | 282 | 382 | 1.1e-17 | 65.1 |
| LXL04_025676 | PF00168.37 | C2 | 408 | 508 | 1.3e-12 | 48.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.