TkA06G010520 | RubberDandelionOmics

Gene overview

TkA06G010520

Reference: TK1151 Chr: Chr06 Coordinates: 2716770-2719170 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2001 bp · TkA06G010520|TK1151|cDNA

TCTTAAAATTTTATTTATCGTAACGATTCCGTCCGATTCTACGATATAAAGTCTCCTTGTTCCTTCCCGCCAACTAGCCAAGTCGCCAAGTCACCAACCTCCACAAAACCCTAGCCTCATTTATATCTTAAACCCTTCACCCCTATTTCTCAGTTACATCAACAGAACCATCTCTAATGGAACCCCAAGCCGTAAAATCGAACATAGTTCTGATCCTAGATTACGGTTCCCAGTACACTCACCTCATTACTCGTCGAATC...

CDS

Download CDS FASTA

1608 bp · TkA06G010520|TK1151|CDS

ATGGAACCCCAAGCCGTAAAATCGAACATAGTTCTGATCCTAGATTACGGTTCCCAGTACACTCACCTCATTACTCGTCGAATCCGGAGCCTAAACATCTTCTCCCTCTGCCTTTCCGGCACCTCATCACTCAAATCCATCACCGATTTAAACCCATCTGTAATAATCCTCTCCGGTGGACCTCATTCTGTCCACTCGCCCGATGCACCTTCTTTCCCAGATGGATTTGTGGACTATGTTGAAAAAAACGGTGTTTTTGT...

Protein

Download Protein FASTA

535 aa · TkA06G010520|TK1151|PROTEIN

MEPQAVKSNIVLILDYGSQYTHLITRRIRSLNIFSLCLSGTSSLKSITDLNPSVIILSGGPHSVHSPDAPSFPDGFVDYVEKNGVFVLGICYGLQLIVQKLGGEVAIGEKQEYGKMVVEVVEDCGGLFEGKKIGDKQVVWMSHGDEAVKLPDGFKVVARSEQGAVAAVENPNKRFYGLQYHPEVTHSPEGMKTLRHFLLKICGVEAGWKMEDVMEEEIKVIRGMVGPQDHVICALSGGVDSTVAATLVHKAIGDRLHCVF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G010520`
TK1151 ID	TkA06G010520
OH-1004 ID	LXL04_002681
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	66.000
Protein coverage (%)	TK1151 28.037 / OH-1004 54.464 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G010520`
Location	Chr06:2716770-2719170 (+)
Description	Similar to guaA: GMP synthase [glutamine-hydrolyzing] (Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_002681` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006177 GMP biosynthetic process Biological Process GO:0005829 cytosol Cellular Component GO:0003921 GMP synthase activity Molecular Function GO:0005524 ATP binding Molecular Function
KEGG gene cross-reference	dra:DR_1874 pmc:P9515_00361 pmm:PMM0037 taf:THA_1090 tme:Tmel_0718 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.761

Rank 1 · TkA06G010520 · TK1151

Nucleus0.301

Rank 2 · TkA06G010520 · TK1151

Mitochondrion0.097

Rank 3 · TkA06G010520 · TK1151

Peroxisome0.069

Rank 4 · TkA06G010520 · TK1151

Cell membrane0.039

Rank 5 · TkA06G010520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00117GATase12-200 aa

PF13507GATase_574-99 aa

PF07722Peptidase_C2682-183 aa

PF13507GATase_5162-184 aa

PF02568ThiI227-278 aa

PF01171ATP_bind_3227-285 aa

PF02540NAD_synthase229-258 aa

PF03054tRNA_Me_trans230-265 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G010520	`PF00117`	GATase	12	200	1.5e-37	129.8
TkA06G010520	`PF13507`	GATase_5	74	99	0.058	13.2
TkA06G010520	`PF07722`	Peptidase_C26	82	183	5.7e-09	36.8
TkA06G010520	`PF13507`	GATase_5	162	184	0.058	13.2
TkA06G010520	`PF02568`	ThiI	227	278	0.00076	19.8
TkA06G010520	`PF01171`	ATP_bind_3	227	285	0.047	13.8
TkA06G010520	`PF02540`	NAD_synthase	229	258	1.3e-07	31.7
TkA06G010520	`PF03054`	tRNA_Me_trans	230	265	0.00024	21.6
TkA06G010520	`PF06508`	QueC	231	301	0.00084	19.6
TkA06G010520	`PF01507`	PAPS_reduct	231	296	0.04	14.6
TkA06G010520	`PF06508`	QueC	368	404	0.00084	19.6
TkA06G010520	`PF03054`	tRNA_Me_trans	381	400	0.00024	21.6
TkA06G010520	`PF02540`	NAD_synthase	382	411	1.3e-07	31.7
TkA06G010520	`PF00958`	GMP_synt_C	444	534	1.1e-40	138.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card