TkA05G444050 | RubberDandelionOmics

Gene overview

TkA05G444050

Reference: TK1151 Chr: Chr05 Coordinates: 111013327-111021378 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

6213 bp · TkA05G444050|TK1151|cDNA

GGACCCGTTATACAGATATACCCACTCCTCTCTCTCTCTCCTCCTCCCAAAAACAAAACTCCTCCCAGTAACGAGTTTCAGCTTGTTAAGAGTTCTTCTCTCTCTTCCAGAAATTAGGGTTCTTTGTCATGCTGTATGATTTGAAGATTCATGAAATTGGGTATGATTTAAAACTCATTTGATCTTCTGTTTGAAGAACCACCCTCTAATTTCCTTCTGTGGGGAAGGAAATTACGCATTTCTATATGAGATCAACTTTT...

CDS

Download CDS FASTA

1095 bp · TkA05G444050|TK1151|CDS

ATGGGAGGAGGTGGTCTAGCTTACGCCGCTGCTATTTGTGTGCTAACTTGCGCAATTCACGCCGTTCATGCAACACCCGACGACCCTGTAATAGTTCAAGTCACAGAGAATCCGAGCAACCACCTCCTCGGGACTCCGACGGAACACAAGTTCACGGCGTTTGTACAAGAACACGGGAAGAAATACTCTACGAGAGAGGAGTACCTGCACCGCCTCGGTGTATTTTCCAAGAATCTTCTTAGAGCTGCCGAACACCAACT...

Protein

Download Protein FASTA

364 aa · TkA05G444050|TK1151|PROTEIN

MGGGGLAYAAAICVLTCAIHAVHATPDDPVIVQVTENPSNHLLGTPTEHKFTAFVQEHGKKYSTREEYLHRLGVFSKNLLRAAEHQLLDPTAVHGVTPFSDLSAEEFESMYLGMKGGGLDRKNSVVGTAPPLEVDGLPEDFDWREKGAVTEVKMQGTCGSCWAFSTTGVIEGANFIATGNLRNLSEQQLVDCDHTCDSSEKDACDSGCSGGLMTNAYNYLMQAGGIQTEETYPYTGKAGECKFDPAKVAVKVANFSNIPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G444050`
TK1151 ID	TkA05G444050
OH-1004 ID	LXL04_022083
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G444050

Location Chr05:111013327-111021378 (-)

Description Similar to RD19D: Probable cysteine protease RD19D

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54940`	Probable thiol protease.	No verified direct reference in this release
`At4g39090`	Probable thiol protease (By similarity).	No verified direct reference in this release
`At2g21430`	Probable thiol protease.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022083 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0051603 proteolysis involved in protein catabolic process Biological Process

GO:0000323 lytic vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005764 lysosome Cellular Component

GO:0005773 vacuole Cellular Component

KEGG gene cross-reference

ath:AT2G21430

ath:AT3G54940

ath:AT4G39090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.703

Rank 1 · TkA05G444050 · TK1151

Extracellular0.186

Rank 2 · TkA05G444050 · TK1151

Cytoplasm0.181

Rank 3 · TkA05G444050 · TK1151

Cell membrane0.115

Rank 4 · TkA05G444050 · TK1151

Endoplasmic reticulum0.111

Rank 5 · TkA05G444050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13292DXP_synthase_N3-67 aa

PF08246Inhibitor_I2951-107 aa

PF00112Peptidase_C1137-361 aa

PF03051Peptidase_C1_2151-171 aa

PF03051Peptidase_C1_2316-344 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G444050	`PF13292`	DXP_synthase_N	3	67	0.11	12.5
TkA05G444050	`PF08246`	Inhibitor_I29	51	107	5.1e-13	49.9
TkA05G444050	`PF00112`	Peptidase_C1	137	361	2e-74	251.1
TkA05G444050	`PF03051`	Peptidase_C1_2	151	171	0.00066	19.3
TkA05G444050	`PF03051`	Peptidase_C1_2	316	344	0.00066	19.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYS0`	Arabidopsis thaliana	sp\|Q8VYS0\|RD19D_ARATH Probable cysteine protease RD19D	67.000%	Swiss-Prot	High
`P43296`	Arabidopsis thaliana	sp\|P43296\|RD19A_ARATH Cysteine protease RD19A	56.000%	Swiss-Prot	High
`P43295`	Arabidopsis thaliana	sp\|P43295\|RD19B_ARATH Probable cysteine protease RD19B	54.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card