TkA05G412140 | RubberDandelionOmics

Gene overview

TkA05G412140

Reference: TK1151 Chr: Chr05 Coordinates: 102519180-102522037 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1020 bp · TkA05G412140|TK1151|cDNA

AAAAAAATCAGCAAACCGGAGGACTATTTTGCAACTTTTTAAATATTAAAATCTAGTGACCTGACTACTTGTTGGGTTCGGCCCTTTTCCTTTCTACACATCCAGGGCCCGTCCAGCTAGCTTCCGATTAACCGCCGGTGGAAACACCGTGCCTTACTCGCTGTCAGCCTACTCGCATCCACCACCATGTCTGGTTCGCTAGGGCGGAAAGTACAAGTCGAGGTTAACTCCTCCGATGCAGGAGACGATGATGATACGGC...

CDS

Download CDS FASTA

660 bp · TkA05G412140|TK1151|CDS

ATGTCTGGTTCGCTAGGGCGGAAAGTACAAGTCGAGGTTAACTCCTCCGATGCAGGAGACGATGATGATACGGCGAAAGCAGATCTCGGCAACGATGAACCCACACCGTCCGACGGCAGCGTCGCAGAAGATCACGATCCTTTCTCCGGGGGTAAAGTCCGTAGGAGAGCATCAATTGCCAGAAGTTTCAAAGGTGATTATGTTGATGTTCGTTCCAAGCCCTATCTCATGAAAATTCTCGAAAAACAAGGTGACAGGGG...

Protein

Download Protein FASTA

219 aa · TkA05G412140|TK1151|PROTEIN

MSGSLGRKVQVEVNSSDAGDDDDTAKADLGNDEPTPSDGSVAEDHDPFSGGKVRRRASIARSFKGDYVDVRSKPYLMKILEKQGDRGVIFADKVLKFTGSGKMKRRILIITDSALYVVDSETYTLKRRIALAAVEKLCLSELSDNFISVIVPTEYDLLMASTHKTEIVSLLVESMKTTSNYELEVHLSNRFEYHATAEIIKEIQFEEVEGGIRTRIVNK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G412140`
TK1151 ID	TkA05G412140
OH-1004 ID	LXL04_021621
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G412140`
Location	Chr05:102519180-102522037 (+)
Description	Similar to myoB: Myosin IB heavy chain
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_021621` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006887 exocytosis Biological Process GO:0006897 endocytosis Biological Process GO:0006907 pinocytosis Biological Process GO:0006909 phagocytosis Biological Process GO:0006911 phagocytosis, engulfment Biological Process GO:0006935 chemotaxis Biological Process GO:0007015 actin filament organization Biological Process GO:0007052 mitotic spindle organization Biological Process GO:0016197 endosomal transport Biological Process GO:0030036 actin cytoskeleton organization Biological Process GO:0030041 actin filament polymerization Biological Process GO:0031270 pseudopodium retraction Biological Process
KEGG gene cross-reference	ddi:DDB_G0275447 ddi:DDB_G0276617 ddi:DDB_G0289117 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.600

Rank 1 · TkA05G412140 · TK1151

Cell membrane0.365

Rank 2 · TkA05G412140 · TK1151

Nucleus0.188

Rank 3 · TkA05G412140 · TK1151

Golgi apparatus0.092

Rank 4 · TkA05G412140 · TK1151

Lysosome / Vacuole0.057

Rank 5 · TkA05G412140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06017Myosin_TH154-207 aa

PF16203ERCC3_RAD25_C72-148 aa

PF14593PH_386-163 aa

PF26659PH_DUOX101-185 aa

PF12456hSac2101-139 aa

PF12456hSac2129-192 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G412140	`PF06017`	Myosin_TH1	54	207	4.9e-36	124.9
TkA05G412140	`PF16203`	ERCC3_RAD25_C	72	148	0.17	11.9
TkA05G412140	`PF14593`	PH_3	86	163	0.022	15.5
TkA05G412140	`PF26659`	PH_DUOX	101	185	0.0066	16.7
TkA05G412140	`PF12456`	hSac2	101	139	0.079	13.2
TkA05G412140	`PF12456`	hSac2	129	192	0.079	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card