TkA05G287010 | RubberDandelionOmics

Gene overview

TkA05G287010

Reference: TK1151 Chr: Chr05 Coordinates: 70878061-70880285 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1770 bp · TkA05G287010|TK1151|cDNA

ATATGATTAATATCACTGCTAGAGGCAGCACTAGCGGCATCATCCTCCGATGATGGAAGAAACTGGAGCAACGCAGCTAACACAGTAGTCCCTACAAATTCAGATGTCGTCCGTTTCAACTTCGATTCTCCGGCACCACTGCACGCCGTTTATATCAACCACCGTTCACCGGTGTGCGTCCAGCTTTTGTTCACTCTCTATCACCGCCTCCAGAAACCAAAACCGTGAAAACGTGTCGAGGAAATCTCAGCAGCCGAGCA...

CDS

Download CDS FASTA

1443 bp · TkA05G287010|TK1151|CDS

ATGTCGTCCGTTTCAACTTCGATTCTCCGGCACCACTGCACGCCGTTTATATCAACCACCGTTCACCGGTGTGCGTCCAGCTTTTGTTCACTCTCTATCACCGCCTCCAGAAACCAAAACCGTGAAAACGTGTCGAGGAAATCTCAGCAGCCGAGCAAGCATCTACTAAAAGCACGCGACACCGTTAAACATTTCTCGTCTCTATCACCGTCTCTCACCTCCACAGATAAGCTCCATCTCTCTCCGGACCAAGCCATCGG...

Protein

Download Protein FASTA

480 aa · TkA05G287010|TK1151|PROTEIN

MSSVSTSILRHHCTPFISTTVHRCASSFCSLSITASRNQNRENVSRKSQQPSKHLLKARDTVKHFSSLSPSLTSTDKLHLSPDQAIGKVASAQANFMRVVVESAKSSSEEEGIGVELLCVVRNLLKKIKRRVLVGDKVLVGSIDWIDRRGMIENVFQRETEILDPPVANVDHLLVFFSLDQPKLEEFSLTRFLVEAESTQIPVTLALNKTELVEKETVVAWKSKLRSWGYEPIFCSVETKTGLDSLQFNLRDQTTVIVGP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G287010`
TK1151 ID	TkA05G287010
OH-1004 ID	LXL04_020657
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G287010

Location Chr05:70878061-70880285 (+)

Description Similar to rsgA: Small ribosomal subunit biogenesis GTPase RsgA 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67440`	One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit.	No verified direct reference in this release
`At1g67460`	Small ribosomal subunit biogenesis GTPase RsgA 2, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020657 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000028 ribosomal small subunit assembly Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0042274 ribosomal small subunit biogenesis Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003924 GTPase activity Molecular Function

GO:0005525 GTP binding Molecular Function

GO:0019843 rRNA binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ana:alr2449

ath:AT1G67440

ath:AT1G67460

ava:Ava_0381

mar:MAE_49420

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.850

Rank 1 · TkA05G287010 · TK1151

Mitochondrion0.102

Rank 2 · TkA05G287010 · TK1151

Nucleus0.086

Rank 3 · TkA05G287010 · TK1151

Cytoplasm0.039

Rank 4 · TkA05G287010 · TK1151

Peroxisome0.013

Rank 5 · TkA05G287010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13671AAA_3328-62 aa

PF13514AAA_2738-77 aa

PF00005ABC_tran50-84 aa

PF15874Il2rg118-159 aa

PF01926MMR_HSR1143-209 aa

PF03193RsgA_GTPase156-340 aa

PF00071Ras191-224 aa

PF02421FeoB_N193-247 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G287010	`PF13671`	AAA_33	28	62	1.4	9.9
TkA05G287010	`PF13514`	AAA_27	38	77	0.15	12.3
TkA05G287010	`PF00005`	ABC_tran	50	84	0.00062	21.1
TkA05G287010	`PF15874`	Il2rg	118	159	0.21	12.6
TkA05G287010	`PF01926`	MMR_HSR1	143	209	5.4e-05	24.0
TkA05G287010	`PF03193`	RsgA_GTPase	156	340	9.1e-50	169.6
TkA05G287010	`PF00071`	Ras	191	224	0.1	12.9
TkA05G287010	`PF02421`	FeoB_N	193	247	0.2	11.9
TkA05G287010	`PF13555`	AAA_29	242	272	0.00011	22.7
TkA05G287010	`PF02456`	Adeno_IVa2	242	275	0.034	13.7
TkA05G287010	`PF01695`	IstB_IS21	243	272	0.23	11.7
TkA05G287010	`PF13175`	AAA_15	245	273	0.015	15.6
TkA05G287010	`PF13514`	AAA_27	245	281	0.15	12.3
TkA05G287010	`PF13476`	AAA_23	246	462	9.1e-07	30.4
TkA05G287010	`PF20703`	nSTAND1	246	271	0.0012	19.2
TkA05G287010	`PF02463`	SMC_N	246	273	0.0071	16.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q4V399`	Arabidopsis thaliana	sp\|Q4V399\|RSGA1_ARATH Small ribosomal subunit biogenesis GTPase RsgA 1, mitochondrial	64.100%	Swiss-Prot	High
`F4HTL8`	Arabidopsis thaliana	sp\|F4HTL8\|RSGA2_ARATH Small ribosomal subunit biogenesis GTPase RsgA 2, mitochondrial	63.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card