LXL04_020657 | RubberDandelionOmics

Gene overview

LXL04_020657

Reference: OH-1004 Chr: Chr04 Coordinates: 102395216-102397113 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1443 bp · LXL04_020657|LXL04_020657|OH1004|cDNA

ATGTCGTCCCTTTCAACTTCGATTCTCCGGCACCACTGCACGCCGTTTATATCAACCACCGTTCACCGGTGTGCGTCCAGCTTTTGTTCACTCTCTATCACCGCCTCCAGAAACCAAAACCGTGAAAACGTGTCGAGGAAATCTCAGCAGCCGAGCAAGCATCTACTCAAAGCACGCGACACCGTTAAACATTTCTCGTCTCTATCACCGTCTCTCACCTCCACAGATAAGCTCCAGCTCTCTCCGGACCAAGCCATCGG...

CDS

Download CDS FASTA

1443 bp · LXL04_020657|LXL04_020657|OH1004|CDS

ATGTCGTCCCTTTCAACTTCGATTCTCCGGCACCACTGCACGCCGTTTATATCAACCACCGTTCACCGGTGTGCGTCCAGCTTTTGTTCACTCTCTATCACCGCCTCCAGAAACCAAAACCGTGAAAACGTGTCGAGGAAATCTCAGCAGCCGAGCAAGCATCTACTCAAAGCACGCGACACCGTTAAACATTTCTCGTCTCTATCACCGTCTCTCACCTCCACAGATAAGCTCCAGCTCTCTCCGGACCAAGCCATCGG...

Protein

Download Protein FASTA

480 aa · LXL04_020657|LXL04_020657|OH1004|PROTEIN

MSSLSTSILRHHCTPFISTTVHRCASSFCSLSITASRNQNRENVSRKSQQPSKHLLKARDTVKHFSSLSPSLTSTDKLQLSPDQAIGKVASAQANFMRVVVESAKSPSEEEGIGVELLCVVRNLLKKIKRRVLVGDKVLVGSIDWIDRRGMIENVFQRETEILDPPVANVDHLLVFFSLDQPKLEEFSLTRFLVEAESTQIPVTLALNKTELVEKETVVAWKSKLRSWGYEPIFCSVETKTGLDSLQFNLRDQTTVIVGP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020657`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020657

Location Chr04:102395216-102397113 (+)

Description Similar to rsgA: Small ribosomal subunit biogenesis GTPase RsgA 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67440`	One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit.	No verified direct reference in this release
`At1g67460`	Small ribosomal subunit biogenesis GTPase RsgA 2, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020657 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000028 ribosomal small subunit assembly Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0042274 ribosomal small subunit biogenesis Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003924 GTPase activity Molecular Function

GO:0005525 GTP binding Molecular Function

GO:0019843 rRNA binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ana:alr2449

ath:AT1G67440

ath:AT1G67460

ava:Ava_0381

mar:MAE_49420

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.853

Rank 1 · LXL04_020657 · OH-1004

Mitochondrion0.103

Rank 2 · LXL04_020657 · OH-1004

Nucleus0.083

Rank 3 · LXL04_020657 · OH-1004

Cytoplasm0.039

Rank 4 · LXL04_020657 · OH-1004

Peroxisome0.013

Rank 5 · LXL04_020657 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03193.23RsgA_GTPase156-340 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020657	`PF03193.23`	RsgA_GTPase	156	340	9.3e-50	169.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q4V399`	Arabidopsis thaliana	Small ribosomal subunit biogenesis GTPase RsgA 1, mitochondrial	66.133%	Swiss-Prot	strong database homology
`F4HTL8`	Arabidopsis thaliana	Small ribosomal subunit biogenesis GTPase RsgA 2, mitochondrial	55.674%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card