TkA04G127200 | RubberDandelionOmics

Gene overview

TkA04G127200

Reference: TK1151 Chr: Chr04 Coordinates: 33033538-33036589 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1927 bp · TkA04G127200|TK1151|cDNA

GAAAGGAAGGAGTTTTGATAGGGGCCGAAGAGCAACTTTTTCGAAATACAACAAAAGGGAAACGAAGAAGCTTCGAGGGCTTACCCGTCGATTACCAAGGTATGCCGTCGGTTAGAATCTCCGGCAACTAACCCTAATTTTAATCTCTGAATGCATCCAAACCAAATTGCTCTGATGGGCGGTGATTACTAAGAAGTTCGATATGAGCACTGAAGTTGGGTGGTACATACTTTCCGAAGATCAACAACACGTAGGTCCAT...

CDS

Download CDS FASTA

1383 bp · TkA04G127200|TK1151|CDS

ATGAGCACTGAAGTTGGGTGGTACATACTTTCCGAAGATCAACAACACGTAGGTCCATATGCTGCTTCCGAATTGAGAGAACACTTTTCTAGTGGATATATTACAGGTGACACACTTGTATGGGCTGAAGGAAGGAGCGAATGGCAGCCCCTTTCCTCTGTTCCTGGATTGATTTCTGACACCCCTGAACAGGAACCCTCACTGGCTGCCATTGATGACGAGTTTGAAAGGTGGCAAAATGAGGTGAAAAGTGCTGAAGC...

Protein

Download Protein FASTA

460 aa · TkA04G127200|TK1151|PROTEIN

MSTEVGWYILSEDQQHVGPYAASELREHFSSGYITGDTLVWAEGRSEWQPLSSVPGLISDTPEQEPSLAAIDDEFERWQNEVKSAEAEADDMRPSSPPDGQEEFTDDDGTVYKWDKKLRAWVPQDEPIAGSEPYDVDHMTFQQEEELFPTIAADGVPVKEDTNTSIIPNADVIAEKETDDANEPTEANGKRKLPEKPVEKKEANQPPDSWFELKVNTHVYVTGLPDDVTFDEVVEVFSKCGIIKEDPETKKPRVKIYVNK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G127200`
TK1151 ID	TkA04G127200
OH-1004 ID	LXL04_035491
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 86.792 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G127200`
Location	Chr04:33033538-33036589 (+)
Description	Similar to Htatsf1: HIV Tat-specific factor 1 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035491` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0034337 RNA folding Biological Process GO:0045292 mRNA cis splicing, via spliceosome Biological Process GO:1903241 U2-type prespliceosome assembly Biological Process GO:1990166 protein localization to site of double-strand break Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005684 U2-type spliceosomal complex Cellular Component GO:0005686 U2 snRNP Cellular Component GO:0035861 site of double-strand break Cellular Component
KEGG gene cross-reference	hsa:27336 mmu:72459 pon:100172491 sce:YNL286W spo:2539783 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.737

Rank 1 · TkA04G127200 · TK1151

Cytoplasm0.407

Rank 2 · TkA04G127200 · TK1151

Cell membrane0.032

Rank 3 · TkA04G127200 · TK1151

Mitochondrion0.032

Rank 4 · TkA04G127200 · TK1151

Endoplasmic reticulum0.024

Rank 5 · TkA04G127200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14237GYF_27-57 aa

PF02213GYF8-51 aa

PF20236DUF659368-134 aa

PF16367RRM_7218-283 aa

PF00076RRM_1219-289 aa

PF28441RRM_11221-284 aa

PF28441RRM_11308-333 aa

PF29326RRM_MUD2_C357-427 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G127200	`PF14237`	GYF_2	7	57	1.1e-17	64.3
TkA04G127200	`PF02213`	GYF	8	51	0.00012	22.4
TkA04G127200	`PF20236`	DUF6593	68	134	0.064	14.2
TkA04G127200	`PF16367`	RRM_7	218	283	0.0042	17.7
TkA04G127200	`PF00076`	RRM_1	219	289	2.1e-17	63.4
TkA04G127200	`PF28441`	RRM_11	221	284	0.0098	16.9
TkA04G127200	`PF28441`	RRM_11	308	333	0.0098	16.9
TkA04G127200	`PF29326`	RRM_MUD2_C	357	427	0.039	14.7
TkA04G127200	`PF28977`	DUF8489	362	394	0.031	15.2
TkA04G127200	`PF00076`	RRM_1	375	427	2.1e-17	63.4
TkA04G127200	`PF28441`	RRM_11	392	405	0.0098	16.9
TkA04G127200	`PF28977`	DUF8489	396	424	0.031	15.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card