TkA03G351770 | RubberDandelionOmics

Gene overview

TkA03G351770

Reference: TK1151 Chr: Chr03 Coordinates: 86638656-86644100 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5356 bp · TkA03G351770|TK1151|cDNA

CAAAGAACAACTTCCTATATATATGTTGCACTTCATTTTCACAACTACAAAACAAATTAAACATCTATTCTTGATATTTCACAAAAAAAAAAAAAAAAAATCATTATTAATGGCACATCTCCCAGGAAGAGCACCTTTTGTTGACAAAAAGAGTTCCAGTCATTTATCATTTGAAGAAATTGTGCCCCCTTCAGCTTGGACAGAAGACGCAACATGCCATTACCTCCTTGTTGATCTTCCCGGTTTCAAGAGGCAGGAGC...

CDS

Download CDS FASTA

3099 bp · TkA03G351770|TK1151|CDS

ATGGCGGAGCAGCAACAGCAACCACCACCGCCTCCGCCAACAAAGCGGATTCGGCGATTGATTGTGGATGTTGCAGATGCGCGTGATCTGCTTCCCAAAGACGGATTAGGCAGCTCGAGTGCTTATGTGGTTGCAGATTTTGATGGTCAGAAGAAGAGGACGTCGACGATTTCTAGGAGCTTGAATCCTGTATGGAATGAGAGCTTGGAGTTTGTGGTGTCGGATCCTAGCACGATGGAATATGAGGAGTTGGAGATTGA...

Protein

Download Protein FASTA

1032 aa · TkA03G351770|TK1151|PROTEIN

MAEQQQQPPPPPPTKRIRRLIVDVADARDLLPKDGLGSSSAYVVADFDGQKKRTSTISRSLNPVWNESLEFVVSDPSTMEYEELEIEVFNDKRLSNGSARKNHFLGRVKLYGSQFARKGDEGLIYFQLEKKSVFSWIRGEIGLRIYYFDDVEVGGDQDTNNDNAQQPPPSEKEGPPQPQQEGRKLEDVRMEAPAPTEVVTENLHQPPMVTVEEAPPAVTVQMENHHNQQHHGIHPPPFHPEYPPEIRRMQTGRVGVGIGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G351770`
TK1151 ID	TkA03G351770
OH-1004 ID	LXL04_008630
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	96.400
Protein coverage (%)	TK1151 98.740 / OH-1004 78.897 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G351770

Location Chr03:86638656-86644100 (+)

Description Similar to QKY: Protein QUIRKY

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74720`	May be involved in Ca 2(+)-dependent signaling and membrane trafficking.	No verified direct reference in this release
`At5g17980`	May function as a signaling molecule by regulating the trafficking of other regulators.	No verified direct reference in this release
`At3g03680`	May function as a signaling molecule by regulating the trafficking of other regulators.	No verified direct reference in this release
`At4g11610`	May function as a signaling molecule by regulating the trafficking of other regulators.	No verified direct reference in this release
`At3g57880`	Required for proliferation and differentiation of shoot stem cells in the shoot apical meristem (SAM), thus determining the appropriate balance between the maintenance of shoot stem cells and their differentiation into other aboveground plant parts via the control of subcellular localization and intercellular trafficking of STM in the shoot apex.	FTIP-Dependent STM Trafficking Regulates Shoot Meristem Development in Arabidopsis.2018 · DOI: 10.1016/j.celrep.2018.04.033

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008630 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009663 plasmodesma organization Biological Process

GO:0009901 anther dehiscence Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010497 plasmodesmata-mediated intercellular transport Biological Process

GO:0010930 negative regulation of auxin mediated signaling pathway Biological Process

GO:0048467 gynoecium development Biological Process

GO:0048729 tissue morphogenesis Biological Process

GO:0051211 anisotropic cell growth Biological Process

GO:0099402 plant organ development Biological Process

GO:1902182 shoot apical meristem development Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G74720

ath:AT3G57880

ath:AT5G17980

dosa:Os05g0370600

osa:4338582

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.539

Rank 1 · TkA03G351770 · TK1151

Endoplasmic reticulum0.246

Rank 2 · TkA03G351770 · TK1151

Cytoplasm0.175

Rank 3 · TkA03G351770 · TK1151

Golgi apparatus0.128

Rank 4 · TkA03G351770 · TK1151

Nucleus0.116

Rank 5 · TkA03G351770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168C219-114 aa

PF00168C2303-405 aa

PF00168C2460-569 aa

PF00168C2618-731 aa

PF24677DUF7657838-897 aa

PF08372PRT_C850-869 aa

PF06398Pex24p852-1010 aa

PF08372PRT_C877-1032 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G351770	`PF00168`	C2	19	114	1.9e-60	202.3
TkA03G351770	`PF00168`	C2	303	405	1.9e-60	202.3
TkA03G351770	`PF00168`	C2	460	569	1.9e-60	202.3
TkA03G351770	`PF00168`	C2	618	731	1.9e-60	202.3
TkA03G351770	`PF24677`	DUF7657	838	897	7.3	5.9
TkA03G351770	`PF08372`	PRT_C	850	869	1e-70	237.3
TkA03G351770	`PF06398`	Pex24p	852	1010	0.002	18.0
TkA03G351770	`PF08372`	PRT_C	877	1032	1e-70	237.3
TkA03G351770	`PF24677`	DUF7657	975	1000	7.3	5.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B8XCH5`	Arabidopsis thaliana	sp\|B8XCH5\|QKY_ARATH Protein QUIRKY	69.100%	Swiss-Prot	High
`Q9FJG3`	Arabidopsis thaliana	sp\|Q9FJG3\|MCT16_ARATH Multiple C2 domain and transmembrane region protein 16	48.000%	Swiss-Prot	Medium
`Q9SS68`	Arabidopsis thaliana	sp\|Q9SS68\|MCT14_ARATH Multiple C2 domain and transmembrane region protein 14	46.800%	Swiss-Prot	Medium
`Q84TJ7`	Arabidopsis thaliana	sp\|Q84TJ7\|MCTP7_ARATH Multiple C2 domain and transmembrane region protein 7	43.900%	Swiss-Prot	Medium
`Q9M2R0`	Arabidopsis thaliana	sp\|Q9M2R0\|FTIP3_ARATH FT-interacting protein 3	55.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card