LXL04_008630 | RubberDandelionOmics

Gene overview

LXL04_008630

Reference: OH-1004 Chr: Chr02 Coordinates: 104627235-104632459 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3756 bp · LXL04_008630|LXL04_008630|OH1004|cDNA

ATGGCACATCTCCCAGGAAGAGCACCTTTTGTTGACAAAAAGAGTTCCAGTCATTTATCATTTGAAGAAATTGTGCCCCCTTCAGCTTGGACAGAAGACGCAACATGCCATTACCTCCTTGTTGATCTTCCCGGTTTCAAGAGGCAGGAGCTAAAGCTTCAAGCCGATAACCGGACTCATATAGTGGTAAGTGGAGAAACGCAAGTGAgagaaaacaaatacaagagATTTGAGCAAAGTTTTGAGTTGCCAAAGAATGC...

CDS

Download CDS FASTA

3756 bp · LXL04_008630|LXL04_008630|OH1004|CDS

ATGGCACATCTCCCAGGAAGAGCACCTTTTGTTGACAAAAAGAGTTCCAGTCATTTATCATTTGAAGAAATTGTGCCCCCTTCAGCTTGGACAGAAGACGCAACATGCCATTACCTCCTTGTTGATCTTCCCGGTTTCAAGAGGCAGGAGCTAAAGCTTCAAGCCGATAACCGGACTCATATAGTGGTAAGTGGAGAAACGCAAGTGAGAGAAAACAAATACAAGAGATTTGAGCAAAGTTTTGAGTTGCCAAAGAATGC...

Protein

Download Protein FASTA

1251 aa · LXL04_008630|LXL04_008630|OH1004|PROTEIN

MAHLPGRAPFVDKKSSSHLSFEEIVPPSAWTEDATCHYLLVDLPGFKRQELKLQADNRTHIVVSGETQVRENKYKRFEQSFELPKNADVDKITGKLDSEILYITVPKKLEHHHQEVKYGGEIESEPKPEPEPESESEPEPEPISNANEIESEPVPGPEHKSNANENKNVENGIERKKHRMGSDENWGKEADLLLKLAIEKLKNNKGIVATAIFAFSLGMLVSHKFQSNYENKEGQESHVSHLLRPTTDDTIMAEQQQQPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008630`
TK1151 ID	TkA03G351770
OH-1004 ID	LXL04_008630
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	96.400
Protein coverage (%)	TK1151 98.740 / OH-1004 78.897 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008630

Location Chr02:104627235-104632459 (-)

Description Similar to QKY: Protein QUIRKY

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74720`	May be involved in Ca 2(+)-dependent signaling and membrane trafficking.	No verified direct reference in this release
`At5g17980`	May function as a signaling molecule by regulating the trafficking of other regulators.	No verified direct reference in this release
`At3g57880`	Required for proliferation and differentiation of shoot stem cells in the shoot apical meristem (SAM), thus determining the appropriate balance between the maintenance of shoot stem cells and their differentiation into other aboveground plant parts via the control of subcellular localization and intercellular trafficking of STM in the shoot apex.	FTIP-Dependent STM Trafficking Regulates Shoot Meristem Development in Arabidopsis.2018 · DOI: 10.1016/j.celrep.2018.04.033
`At1g51570`	Required for proliferation and differentiation of shoot stem cells in the shoot apical meristem (SAM), thus determining the appropriate balance between the maintenance of shoot stem cells and their differentiation into other aboveground plant parts via the control of subcellular localization and intercellular trafficking of STM in the shoot apex.	FTIP-Dependent STM Trafficking Regulates Shoot Meristem Development in Arabidopsis.2018 · DOI: 10.1016/j.celrep.2018.04.033

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0370600`	Promotes nuclear translocation of the transcription factor OSH1, which directly suppresses the auxin biosynthetic gene YUCCA4 during the late development of anthers.	OsFTIP7 determines auxin-mediated anther dehiscence in rice.2018 · DOI: 10.1038/s41477-018-0175-0

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008630 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009663 plasmodesma organization Biological Process

GO:0009901 anther dehiscence Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010497 plasmodesmata-mediated intercellular transport Biological Process

GO:0010930 negative regulation of auxin mediated signaling pathway Biological Process

GO:0048467 gynoecium development Biological Process

GO:0048729 tissue morphogenesis Biological Process

GO:0051211 anisotropic cell growth Biological Process

GO:0099402 plant organ development Biological Process

GO:1902182 shoot apical meristem development Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G74720

ath:AT3G57880

ath:AT5G17980

dosa:Os05g0370600

osa:4338582

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.592

Rank 1 · LXL04_008630 · OH-1004

Endoplasmic reticulum0.193

Rank 2 · LXL04_008630 · OH-1004

Cytoplasm0.150

Rank 3 · LXL04_008630 · OH-1004

Nucleus0.126

Rank 4 · LXL04_008630 · OH-1004

Golgi apparatus0.082

Rank 5 · LXL04_008630 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00011.28HSP2031-115 aa

PF00168.37C2270-365 aa

PF00168.37C2522-624 aa

PF00168.37C2679-788 aa

PF00168.37C2837-950 aa

PF08372.17PRT_C1096-1251 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008630	`PF00011.28`	HSP20	31	115	6.5e-12	46.2
LXL04_008630	`PF00168.37`	C2	270	365	5.9e-60	200.7
LXL04_008630	`PF00168.37`	C2	522	624	5.9e-60	200.7
LXL04_008630	`PF00168.37`	C2	679	788	5.9e-60	200.7
LXL04_008630	`PF00168.37`	C2	837	950	5.9e-60	200.7
LXL04_008630	`PF08372.17`	PRT_C	1096	1251	1.3e-70	236.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B8XCH5`	Arabidopsis thaliana	Protein QUIRKY	67.904%	Swiss-Prot	strong database homology
`Q9FJG3`	Arabidopsis thaliana	Multiple C2 domain and transmembrane region protein 16	55.762%	Swiss-Prot	moderate database homology
`Q9M2R0`	Arabidopsis thaliana	FT-interacting protein 3	55.658%	Swiss-Prot	moderate database homology
`Q9C8H3`	Arabidopsis thaliana	FT-interacting protein 4	54.796%	Swiss-Prot	moderate database homology
`Q60EW9`	Oryza sativa subsp. japonica	FT-interacting protein 7	55.425%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card