TkA03G325630 | RubberDandelionOmics

Gene overview

TkA03G325630

Reference: TK1151 Chr: Chr03 Coordinates: 79986030-79988830 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1602 bp · TkA03G325630|TK1151|cDNA

GTTGAGAAGGCCTATTTTGACCATGCTTTTAACGTTTTCGTCTACATAAACTGGAAAACACATTTCCACGACCAACTGCTATCTTTCCATACAGGACAAATCCCCGATAATCTCTATAAAACAGTCGCTGATTCACCATCCATAAAGTGGTGAAAGAAAATCAAATATACCCAATTCCTTCTTCAGTATGGAGGTAAGATCAAGAGCCCCGGGGAAGATCATACTCGCCGGAGAACATGCCGTTGTTCATGGATCCGCTG...

CDS

Download CDS FASTA

1158 bp · TkA03G325630|TK1151|CDS

ATGGAGGTAAGATCAAGAGCCCCGGGGAAGATCATACTCGCCGGAGAACATGCCGTTGTTCATGGATCCGCTGCCGTCGCCGCCTCTATTGGCCTGTACACATCCGTCACTCTTCGCTTCCCTTCACCTTCTGATAATGACGATAATACCCTCACACTCTACCTGAAGGACGTGGGCCTAGATTTTTCATGGCCAATCGGAAGAATCAAAGAGATATTACCAGATTCAGTCAATACTATCGCATCATCACCCAAGACATG...

Protein

Download Protein FASTA

385 aa · TkA03G325630|TK1151|PROTEIN

MEVRSRAPGKIILAGEHAVVHGSAAVAASIGLYTSVTLRFPSPSDNDDNTLTLYLKDVGLDFSWPIGRIKEILPDSVNTIASSPKTCSPETIKLLSKLVEEHKIPESQIGIASGVIAFLWLYTSIQGNKPATITVSSELPLGSGLGSSAAFCVSLSGAFLASSDSVKVDFGQNGWVAFGEKEQQLANKWAFEGEKIIHGKPSGIDNTVSTFGNLIKFKLGDLTCIKSNMILKMLITNTKVGRNTKALVAGVTERKNRHPD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G325630`
TK1151 ID	TkA03G325630
OH-1004 ID	LXL04_007509
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G325630

Location Chr03:79986030-79988830 (-)

Description Similar to At5g27450: Mevalonate kinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g27450`	Catalyzes the phosphorylation of mevalonate to mevalonate 5-phosphate, a key step in isoprenoid and cholesterol biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007509 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006695 cholesterol biosynthetic process Biological Process

GO:0006720 isoprenoid metabolic process Biological Process

GO:0008299 isoprenoid biosynthetic process Biological Process

GO:0010142 farnesyl diphosphate biosynthetic process, mevalonate pathway Biological Process

GO:0016125 sterol metabolic process Biological Process

GO:0016126 sterol biosynthetic process Biological Process

GO:0016310 phosphorylation Biological Process

GO:0017148 negative regulation of translation Biological Process

GO:0019287 isopentenyl diphosphate biosynthetic process, mevalonate pathway Biological Process

GO:0033386 geranylgeranyl diphosphate biosynthetic process Biological Process

GO:0033489 cholesterol biosynthetic process via desmosterol Biological Process

GO:0033490 cholesterol biosynthetic process via lathosterol Biological Process

KEGG gene cross-reference

ath:AT5G27450

bta:505792

ddi:DDB_G0272018

hsa:4598

rno:81727

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.708

Rank 1 · TkA03G325630 · TK1151

Nucleus0.266

Rank 2 · TkA03G325630 · TK1151

Peroxisome0.143

Rank 3 · TkA03G325630 · TK1151

Mitochondrion0.099

Rank 4 · TkA03G325630 · TK1151

Cell membrane0.040

Rank 5 · TkA03G325630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10509GalKase_gal_bdg5-37 aa

PF00288GHMP_kinases_N22-31 aa

PF00288GHMP_kinases_N127-212 aa

PF08544GHMP_kinases_C293-345 aa

PF08544GHMP_kinases_C353-375 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G325630	`PF10509`	GalKase_gal_bdg	5	37	0.24	11.7
TkA03G325630	`PF00288`	GHMP_kinases_N	22	31	2.2e-08	34.9
TkA03G325630	`PF00288`	GHMP_kinases_N	127	212	2.2e-08	34.9
TkA03G325630	`PF08544`	GHMP_kinases_C	293	345	1.1e-06	29.7
TkA03G325630	`PF08544`	GHMP_kinases_C	353	375	1.1e-06	29.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P46086`	Arabidopsis thaliana	sp\|P46086\|KIME_ARATH Mevalonate kinase	63.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card