TkA02G369320 | RubberDandelionOmics

Gene overview

TkA02G369320

Reference: TK1151 Chr: Chr02 Coordinates: 93966931-93971452 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

447 bp · TkA02G369320|TK1151|cDNA

ATGGCTATTTCAGCTTCATCATCATCTTCATCTTCCTTCTTTACTTCCCCAAAATTTCACCTCAACTTACACCCACCGTCGCAAGCAATTTCAACCTCCGTCAGATTCGGAAGATTTCGGATGTCAGCTGCCTACGCCACAGCTTCACGTAATACTAGTCCCTCCTCGCTGTATCAGGTGCTGGGGGTTCAAGTCGGAGCTGATATCACAGAGGTGAAAGCGGCGTATCGTAGGTTAGCGAGAGTTTTGCATCCTGATGT...

CDS

Download CDS FASTA

447 bp · TkA02G369320|TK1151|CDS

ATGGCTATTTCAGCTTCATCATCATCTTCATCTTCCTTCTTTACTTCCCCAAAATTTCACCTCAACTTACACCCACCGTCGCAAGCAATTTCAACCTCCGTCAGATTCGGAAGATTTCGGATGTCAGCTGCCTACGCCACAGCTTCACGTAATACTAGTCCCTCCTCGCTGTATCAGGTGCTGGGGGTTCAAGTCGGAGCTGATATCACAGAGGTGAAAGCGGCGTATCGTAGGTTAGCGAGAGTTTTGCATCCTGATGT...

Protein

Download Protein FASTA

148 aa · TkA02G369320|TK1151|PROTEIN

MAISASSSSSSSFFTSPKFHLNLHPPSQAISTSVRFGRFRMSAAYATASRNTSPSSLYQVLGVQVGADITEVKAAYRRLARVLHPDVASHESSADEFMKVHSAYITLCDPVKRAVYDRSLVQMRSAGLVQMRSAGSYRSRRWETDQCW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G369320`
TK1151 ID	TkA02G369320
OH-1004 ID	LXL04_015096
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	65.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G369320

Location Chr02:93966931-93971452 (+)

Description Similar to ATJ11: Chaperone protein dnaJ 11, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36040`	Plays a continuous role in plant development probably in the structural organization of compartments.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015096 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006457 protein folding Biological Process

GO:0009408 response to heat Biological Process

GO:0010322 regulation of isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway Biological Process

GO:0042026 protein refolding Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G13830

ath:AT4G36040

bbe:BBR47_20310

mth:MTH_1291

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.918

Rank 1 · TkA02G369320 · TK1151

Nucleus0.066

Rank 2 · TkA02G369320 · TK1151

Mitochondrion0.058

Rank 3 · TkA02G369320 · TK1151

Cytoplasm0.026

Rank 4 · TkA02G369320 · TK1151

Cell membrane0.008

Rank 5 · TkA02G369320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226DnaJ21-28 aa

PF13609Porin_429-80 aa

PF00226DnaJ57-117 aa

PF30912TIM141_C59-88 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G369320	`PF00226`	DnaJ	21	28	2e-18	67.0
TkA02G369320	`PF13609`	Porin_4	29	80	0.17	12.4
TkA02G369320	`PF00226`	DnaJ	57	117	2e-18	67.0
TkA02G369320	`PF30912`	TIM141_C	59	88	0.037	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FYB5`	Arabidopsis thaliana	sp\|Q9FYB5\|DNJ11_ARATH Chaperone protein dnaJ 11, chloroplastic	53.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card