TkA02G362910 | RubberDandelionOmics

Gene overview

TkA02G362910

Reference: TK1151 Chr: Chr02 Coordinates: 92323170-92328975 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1712 bp · TkA02G362910|TK1151|cDNA

AAAAAAGTGCTAGTACTCATCATATATATCATCTATACATAGTTTAGAGACCGATGCCATTTCTGATACAAACCCAAATTTGTGTTAAAAGCTATTTATCTCATTTTCTTGAATTTGGATATAGTTTTTGCAATGCTTCTTTCAGTTACATACGTCATTCTTTTCTGTACATTTTTCTCTACCTATTTATGCCACAGCAAGGAAGCAGTAAATCTCGTAGAAAATGTCTCTATACCAGCAGTCATTGCATTTGGAGACTC...

CDS

Download CDS FASTA

1002 bp · TkA02G362910|TK1151|CDS

ATGCTTCTTTCAGTTACATACGTCATTCTTTTCTGTACATTTTTCTCTACCTATTTATGCCACAGCAAGGAAGCAGTAAATCTCGTAGAAAATGTCTCTATACCAGCAGTCATTGCATTTGGAGACTCCTATTTGGATCAGGGTAATAACAACTATATCAAGACTTTGATCAAGGCCAATTTTCACCCCTACGGTAAAGATTTTGTTGATGGAAAAGCAACGGGAAGGTTCACCGATGGGAAATCTCTAGCTGACTTTTT...

Protein

Download Protein FASTA

333 aa · TkA02G362910|TK1151|PROTEIN

MLLSVTYVILFCTFFSTYLCHSKEAVNLVENVSIPAVIAFGDSYLDQGNNNYIKTLIKANFHPYGKDFVDGKATGRFTDGKSLADFFAQPVIRPLHLLRRDSGHFIFSDEIPASSPVESAQSGLATATCCTCRVSSSTSDIVIDVNETQKIDNSIGYDLSPEIEHKLPPIITKSAIARPSSRNTQTSHSGKKVKEANKIPARKSLSGVKIRANSPKLAVSKRIGQKSAQRKNLSESFAIVKSSYDPQRDFMESMMGMIVE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G362910`
TK1151 ID	TkA02G362910
OH-1004 ID	LXL04_015134
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.000
Protein coverage (%)	TK1151 89.489 / OH-1004 25.190 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G362910

Location Chr02:92323170-92328975 (-)

Description Similar to EXL3: GDSL esterase/lipase EXL3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75900`	GDSL esterase/lipase EXL3.	No verified direct reference in this release
`UniProt: Q9FHW9`	GDSL esterase/lipase At5g42170.	No verified direct reference in this release
`At1g20120`	GDSL esterase/lipase At1g20120.	No verified direct reference in this release
`At3g43550`	GDSL esterase/lipase At3g43550.	No verified direct reference in this release
`At1g58725`	GDSL esterase/lipase At1g58725.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015134 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0016298 lipase activity Molecular Function

GO:0016746 acyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G75880

ath:AT1G75900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.356

Rank 1 · TkA02G362910 · TK1151

Nucleus0.335

Rank 2 · TkA02G362910 · TK1151

Cell membrane0.219

Rank 3 · TkA02G362910 · TK1151

Endoplasmic reticulum0.124

Rank 4 · TkA02G362910 · TK1151

Plastid0.082

Rank 5 · TkA02G362910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657Lipase_GDSL37-92 aa

PF27117FliB_C221-305 aa

PF04844Ovate243-290 aa

PF21698Spo16_C255-281 aa

PF28679IL27RA_N276-328 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G362910	`PF00657`	Lipase_GDSL	37	92	0.0052	17.7
TkA02G362910	`PF27117`	FliB_C	221	305	0.028	15.1
TkA02G362910	`PF04844`	Ovate	243	290	2.3e-20	73.0
TkA02G362910	`PF21698`	Spo16_C	255	281	0.09	13.2
TkA02G362910	`PF28679`	IL27RA_N	276	328	0.031	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94CH6`	Arabidopsis thaliana	sp\|Q94CH6\|EXL3_ARATH GDSL esterase/lipase EXL3	48.400%	Swiss-Prot	Medium
`Q9FHW9`	Arabidopsis thaliana	sp\|Q9FHW9\|GDL90_ARATH GDSL esterase/lipase At5g42170	48.100%	Swiss-Prot	Medium
`P0DKJ6`	Arabidopsis thaliana	sp\|P0DKJ6\|GDL4_ARATH GDSL esterase/lipase At1g20120	49.300%	Swiss-Prot	Medium
`Q3EAQ9`	Arabidopsis thaliana	sp\|Q3EAQ9\|GDL55_ARATH GDSL esterase/lipase At3g43550	50.200%	Swiss-Prot	High
`Q3ECM4`	Arabidopsis thaliana	sp\|Q3ECM4\|GDL25_ARATH GDSL esterase/lipase At1g58725	50.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card