TkA02G180130 | RubberDandelionOmics

Gene overview

TkA02G180130

Reference: TK1151 Chr: Chr02 Coordinates: 46326730-46332107 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1048 bp · TkA02G180130|TK1151|cDNA

AGTGGCCAGGACCATTTGATTGTTCTATCACATAACTTCGTTCGTTTTTCGTCTCAGTTGATCTCCTATGTTTTTTCATGAATCTTTTTGTTTACTTCTTCTTCACTGAAGACAAAGGTCAAGCTAGAAAGTCCCTCCTTGGCTCCTTCGCAGCCTCTTTAATTTTTCATATGCTTGTTATAAAAGTGGCTTCCCATAAACTTTCTACAGCAAATAACTAGACGGGTTTACCAAATCCTTGAAGCGTACCTTCAATGGCA...

CDS

Download CDS FASTA

564 bp · TkA02G180130|TK1151|CDS

ATGGCATCTTCCTCAACTTCATCCATCGACAAAAGCTTTAAATATGATGTGTTTTTAAGTTTTAGAGGCGAAGACACTCGTACAAACTTCGTCGATCATCTTTATTCTGCTCTTGAGCATAAAAACATTTACACTTACAAGGATGACCAAAGAATCAAGAAAGGGAAAAGAATCAGTGATGAGCTCATCAGATCCATTCAAGACTCAAAGTTTTACATCATTGTTTTCTCCAAGAACTATGCATCTTCATCTTGGTGCTT...

Protein

Download Protein FASTA

187 aa · TkA02G180130|TK1151|PROTEIN

MASSSTSSIDKSFKYDVFLSFRGEDTRTNFVDHLYSALEHKNIYTYKDDQRIKKGKRISDELIRSIQDSKFYIIVFSKNYASSSWCLDELVNIMECHKTTEHTAYPIFYDVEPSEVRKQSGTVGEAFAQHEKATAAGKWRETLKEAADLAGWELKKTTDGKNTTVVQGDKGKKNTSHVVVRTAGGPR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G180130`
TK1151 ID	TkA02G180130
OH-1004 ID	LXL04_016176
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.200
Protein coverage (%)	TK1151 89.305 / OH-1004 16.120 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G180130

Location Chr02:46326730-46332107 (+)

Description Similar to RPV1: Disease resistance protein RPV1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72930`	Disease resistance protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016176 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003953 NAD+ nucleosidase activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0043531 ADP binding Molecular Function

GO:0050135 NADP+ nucleosidase activity Molecular Function

GO:0061809 NAD+ nucleosidase activity, cyclic ADP-ribose generating Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.440

Rank 1 · TkA02G180130 · TK1151

Cytoplasm0.367

Rank 2 · TkA02G180130 · TK1151

Nucleus0.144

Rank 3 · TkA02G180130 · TK1151

Endoplasmic reticulum0.108

Rank 4 · TkA02G180130 · TK1151

Mitochondrion0.049

Rank 5 · TkA02G180130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01582TIR14-159 aa

PF26659PH_DUOX14-43 aa

PF13676TIR_217-113 aa

PF10137CAP12-PCTIR_TIR30-79 aa

PF05075DUF68445-83 aa

PF09014Sushi_279-117 aa

PF10137CAP12-PCTIR_TIR128-154 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G180130	`PF01582`	TIR	14	159	5.4e-49	167.1
TkA02G180130	`PF26659`	PH_DUOX	14	43	0.033	14.5
TkA02G180130	`PF13676`	TIR_2	17	113	3.9e-16	60.3
TkA02G180130	`PF10137`	CAP12-PCTIR_TIR	30	79	0.17	12.6
TkA02G180130	`PF05075`	DUF684	45	83	0.038	13.7
TkA02G180130	`PF09014`	Sushi_2	79	117	0.052	14.2
TkA02G180130	`PF10137`	CAP12-PCTIR_TIR	128	154	0.17	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SSN3`	Arabidopsis thaliana	sp\|Q9SSN3\|TIR_ARATH Toll/interleukin-1 receptor-like protein	50.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card