TkA02G103370 | RubberDandelionOmics

Gene overview

TkA02G103370

Reference: TK1151 Chr: Chr02 Coordinates: 27063276-27063614 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

339 bp · TkA02G103370|TK1151|cDNA

ATGGTCTTCGTTACCACTTCTGCAATCACACCGGAATACAACCGGAAAGCTGAGCTCACGGCGTTTGACGAAACCAAAACCGGCGTCAAAGGACTTATAGATGCCGGAATAACGGAGGTCCCTCGGATGTTCCTCCTACCTGGACCTGAAAACCTAGACTCCAACCAATCAGAGCTTACCCTTCCGACCATCGATTTCGACGGAATCGATGAAGATCCGGTGCGGCGAAAGGAGGTGATTGCGAAAATGAAGGATGCGTT...

CDS

Download CDS FASTA

339 bp · TkA02G103370|TK1151|CDS

ATGGTCTTCGTTACCACTTCTGCAATCACACCGGAATACAACCGGAAAGCTGAGCTCACGGCGTTTGACGAAACCAAAACCGGCGTCAAAGGACTTATAGATGCCGGAATAACGGAGGTCCCTCGGATGTTCCTCCTACCTGGACCTGAAAACCTAGACTCCAACCAATCAGAGCTTACCCTTCCGACCATCGATTTCGACGGAATCGATGAAGATCCGGTGCGGCGAAAGGAGGTGATTGCGAAAATGAAGGATGCGTT...

Protein

Download Protein FASTA

112 aa · TkA02G103370|TK1151|PROTEIN

MVFVTTSAITPEYNRKAELTAFDETKTGVKGLIDAGITEVPRMFLLPGPENLDSNQSELTLPTIDFDGIDEDPVRRKEVIAKMKDALESWGFFQMVNHKILISVMGFRDLRY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G103370`
TK1151 ID	TkA02G103370
OH-1004 ID	LXL04_029679
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.900
Protein coverage (%)	TK1151 84.821 / OH-1004 38.306 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G103370

Location Chr02:27063276-27063614 (-)

Description Similar to ACO3: 1-aminocyclopropane-1-carboxylate oxidase homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g25450`	Necessary for the hydroxylation of but-3-enyl glucosinolate to 2-hydroxybut-3-enyl glucosinolate, which is toxic to insects, bacteria and nematodes, inhibits seed germination and produces bitter flavors.	A novel 2-oxoacid-dependent dioxygenase involved in the formation of the goiterogenic 2-hydroxybut-3-enyl glucosinolate and generalist insect resistance in Arabidopsis,.2008 · DOI: 10.1104/pp.108.129981
`At1g04350`	1-aminocyclopropane-1-carboxylate oxidase homolog 6.	No verified direct reference in this release
`At1g06620`	1-aminocyclopropane-1-carboxylate oxidase homolog 1.	No verified direct reference in this release
`At5g59530`	1-aminocyclopropane-1-carboxylate oxidase homolog 11.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029679 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002238 response to molecule of fungal origin Biological Process

GO:0009693 ethylene biosynthetic process Biological Process

GO:0009805 coumarin biosynthetic process Biological Process

GO:0009835 fruit ripening Biological Process

GO:0010439 regulation of glucosinolate biosynthetic process Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

KEGG gene cross-reference

ath:AT1G04350

ath:AT1G06640

ath:AT1G06650

ath:AT2G25450

sly:101268031

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.815

Rank 1 · TkA02G103370 · TK1151

Nucleus0.388

Rank 2 · TkA02G103370 · TK1151

Endoplasmic reticulum0.049

Rank 3 · TkA02G103370 · TK1151

Mitochondrion0.033

Rank 4 · TkA02G103370 · TK1151

Peroxisome0.028

Rank 5 · TkA02G103370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226DIOX_N61-100 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G103370	`PF14226`	DIOX_N	61	100	7.2e-09	37.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKK4`	Arabidopsis thaliana	sp\|Q9SKK4\|GSL_ARATH Probable 2-oxoacid dependent dioxygenase	49.500%	Swiss-Prot	Medium
`P93824`	Arabidopsis thaliana	sp\|P93824\|ACCH6_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 6	46.000%	Swiss-Prot	Medium
`Q84MB3`	Arabidopsis thaliana	sp\|Q84MB3\|ACCH1_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 1	50.000%	Swiss-Prot	High
`Q9LTH8`	Arabidopsis thaliana	sp\|Q9LTH8\|ACH11_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 11	46.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card