TkA02G084500 | RubberDandelionOmics

Gene overview

TkA02G084500

Reference: TK1151 Chr: Chr02 Coordinates: 21942876-21943891 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

963 bp · TkA02G084500|TK1151|cDNA

ATGGCTGAAGCAGTAGCAACAGGTGCTGGTGTGGCAGCAACTGTTATCCAAGCTAAGGCAATATTATTGCAACCATTAAAGCAAACAATTGCATCATCCAATGATATGGACGAAATCTATGGAGAGTTAGGTCGTGTAATGGAAACACTCATTGCAAGAAGAAACGATCATGATGAAGACCGCCTTTCGGATGTGGTTGCAAAAGAAGTAGATGAATTAAAAGTCAGATACACTAAGGAAAATAAACGGTCACCATGGTT...

CDS

Download CDS FASTA

963 bp · TkA02G084500|TK1151|CDS

ATGGCTGAAGCAGTAGCAACAGGTGCTGGTGTGGCAGCAACTGTTATCCAAGCTAAGGCAATATTATTGCAACCATTAAAGCAAACAATTGCATCATCCAATGATATGGACGAAATCTATGGAGAGTTAGGTCGTGTAATGGAAACACTCATTGCAAGAAGAAACGATCATGATGAAGACCGCCTTTCGGATGTGGTTGCAAAAGAAGTAGATGAATTAAAAGTCAGATACACTAAGGAAAATAAACGGTCACCATGGTT...

Protein

Download Protein FASTA

320 aa · TkA02G084500|TK1151|PROTEIN

MAEAVATGAGVAATVIQAKAILLQPLKQTIASSNDMDEIYGELGRVMETLIARRNDHDEDRLSDVVAKEVDELKVRYTKENKRSPWFSINARSNFTKKMKKTAFWVVTLIEENNHLVDVLVDKKPACVIDMLTSQITNIPTLQQSLEETLDLLCNKEVSDIKIYGLVGSGKRIIMKNLNNHIKVAEMFDIVIWVSVSRKGNMKHRDINQIQQDIIERLELNIGITSNVDLIANRIRAELTNIKYLLLLDDVNEDLDLDKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G084500`
TK1151 ID	TkA02G084500
OH-1004 ID	LXL04_016996
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G084500

Location Chr02:21942876-21943891 (+)

Description Similar to At5g43740: Probable disease resistance protein At5g43740

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12220`	Disease resistance (R) protein that specifically recognizes the avrPphB type III effector avirulence protein from Pseudomonas syringae.	No verified direct reference in this release
`At1g61300`	Probable disease resistance protein.	No verified direct reference in this release
`At1g51480`	Probable disease resistance protein.	No verified direct reference in this release
`At4g26090`	Disease resistance (R) protein that specifically recognizes the AvrRpt2 type III effector avirulence protein from Pseudomonas syringae.	No verified direct reference in this release
`At1g12280`	Disease resistance protein that mediates defense responses against the bacterial pathogen Pseudomonas syringae pv tomato strain DC3000, and the virulent oomycete Hyaloperonospora arabidopsidis isolate Noco2.	The MEKK1-MKK1/MKK2-MPK4 kinase cascade negatively regulates immunity mediated by a mitogen-activated protein kinase kinase kinase in Arabidopsis.2012 · DOI: 10.1105/tpc.112.097253

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016996 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process

GO:0006952 defense response Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0012501 programmed cell death Biological Process

GO:0016045 detection of bacterium Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G12220

ath:AT4G26090

ath:AT5G43730

ath:AT5G43740

ath:AT5G63020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.699

Rank 1 · TkA02G084500 · TK1151

Cytoplasm0.146

Rank 2 · TkA02G084500 · TK1151

Endoplasmic reticulum0.115

Rank 3 · TkA02G084500 · TK1151

Nucleus0.089

Rank 4 · TkA02G084500 · TK1151

Extracellular0.054

Rank 5 · TkA02G084500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23302HTH_DNAJC940-80 aa

PF25201nSTAND641-87 aa

PF14535AMP-binding_C_2119-125 aa

PF00931NB-ARC143-306 aa

PF25201nSTAND6157-196 aa

PF14535AMP-binding_C_2189-233 aa

PF14535AMP-binding_C_2255-297 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G084500	`PF23302`	HTH_DNAJC9	40	80	0.11	13.5
TkA02G084500	`PF25201`	nSTAND6	41	87	0.046	14.5
TkA02G084500	`PF14535`	AMP-binding_C_2	119	125	0.24	12.4
TkA02G084500	`PF00931`	NB-ARC	143	306	2.1e-29	103.0
TkA02G084500	`PF25201`	nSTAND6	157	196	0.046	14.5
TkA02G084500	`PF14535`	AMP-binding_C_2	189	233	0.24	12.4
TkA02G084500	`PF14535`	AMP-binding_C_2	255	297	0.24	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64973`	Arabidopsis thaliana	sp\|O64973\|RPS5_ARATH Disease resistance protein RPS5	31.300%	Swiss-Prot	Medium
`O64790`	Arabidopsis thaliana	sp\|O64790\|DRL17_ARATH Probable disease resistance protein At1g61300	32.100%	Swiss-Prot	Medium
`Q9C8K0`	Arabidopsis thaliana	sp\|Q9C8K0\|DRL5_ARATH Probable disease resistance protein At1g51480	37.000%	Swiss-Prot	Medium
`Q42484`	Arabidopsis thaliana	sp\|Q42484\|RPS2_ARATH Disease resistance protein RPS2	35.600%	Swiss-Prot	Medium
`P60838`	Arabidopsis thaliana	sp\|P60838\|SUMM2_ARATH Disease resistance protein SUMM2	34.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card