Gene Card
Gene overview
cDNA / CDS / Protein Sequences
919 bp · TkA01G366450|TK1151|cDNA
TGCACTGGTACCTCCTCAACCCGGGGAGAAATCGTAAATTATCCTACCCGTCCAGTCGACACAAACACAGATTTTGAAGGCACAACAAGTCTTCAGCCTGCTCAACAGGCATCAGGAAACGTGTCCGGGGGTATGGGCCCACACGTAATGCCGACTAGAAACGTTCCACGCCCTATGCACATGGTCGGCATGCAGAGGATGCAGCAGCAGAGTATGGCGGCTTATAACCTCGCCTCTCAGGCAATCAACCCCGCGAATAT...
1110 bp · TkA01G366450|TK1151|CDS
ATGAGCAACAGAGGTAATAGTAGTGGAAGTGGTAGCAACAGCAACATCAGTTCTTCCAATCGCCCTGAATGGTTGCAACAGTACGACTTGATTGGTAAAATTGGCGAGGGAACTTACGGTCTTGTGTTTTTGGCGAAGATCAAATCCAATCGGAGCAAGTCAATCGCGATTAAGAAGTTCAAGCAATCCAAAGACGGCGATGGTGTTTCCCCTACGGCAATCCGCGAAATCATGTTGCTTAGGGAGATATCCCATGATAA...
Protein
Download Protein FASTA369 aa · TkA01G366450|TK1151|PROTEIN
MSNRGNSSGSGSNSNISSSNRPEWLQQYDLIGKIGEGTYGLVFLAKIKSNRSKSIAIKKFKQSKDGDGVSPTAIREIMLLREISHDNVVKLVNVHINHIDMSLYLAFDYAEHDLYEIIRHHRDKVNQAINQYTVKSILWQLLNGLNYLHSNWIMHRDLKPSNILVMGDGEEQGVVKIADFGLARIYQAPLKPLFDNGVVVTIWYRAPELLLGGKHYTSAVDMWAVGCIFAELLTLKPLFQGQEVKATPNPFQLDQLDKIF...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G366450 |
|---|---|
| TK1151 ID | TkA01G366450 |
| OH-1004 ID | LXL04_003378 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 91.057 / OH-1004 71.489Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G366450 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:91325930-91331529 (-) | ||||||||||||
| Description | Similar to CDKE-1: Cyclin-dependent kinase E-1 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0000082 G1/S transition of mitotic cell cycle Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006468 protein phosphorylation Biological Process GO:0010344 seed oilbody biogenesis Biological Process GO:0010628 positive regulation of gene expression Biological Process GO:0034472 snRNA 3'-end processing Biological Process GO:0050821 protein stabilization Biological Process GO:0051301 cell division Biological Process GO:0000307 cyclin-dependent protein kinase holoenzyme complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0016592 mediator complex Cellular Component | ||||||||||||
| KEGG gene cross-reference | aag:5574480 ath:AT5G63610 ddi:DDB_G0267442 dme:Dmel_CG10572 dosa:Os10g0580300 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13095FTA226-65 aaPF00069Pkinase28-336 aaPF07714PK_Tyr_Ser-Thr31-235 aaPF06293Kdo72-180 aaPF13095FTA2111-164 aaPF03109ABC1129-187 aaPF10707YrbL-PhoP_reg133-181 aaPF01636APH149-186 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G366450 | PF13095 | FTA2 | 26 | 65 | 0.065 | 13.6 |
| TkA01G366450 | PF00069 | Pkinase | 28 | 336 | 6.4e-68 | 229.7 |
| TkA01G366450 | PF07714 | PK_Tyr_Ser-Thr | 31 | 235 | 2.2e-32 | 113.1 |
| TkA01G366450 | PF06293 | Kdo | 72 | 180 | 0.076 | 13.2 |
| TkA01G366450 | PF13095 | FTA2 | 111 | 164 | 0.065 | 13.6 |
| TkA01G366450 | PF03109 | ABC1 | 129 | 187 | 0.044 | 13.6 |
| TkA01G366450 | PF10707 | YrbL-PhoP_reg | 133 | 181 | 0.23 | 11.9 |
| TkA01G366450 | PF01636 | APH | 149 | 186 | 0.095 | 13.2 |
| TkA01G366450 | PF07714 | PK_Tyr_Ser-Thr | 309 | 329 | 2.2e-32 | 113.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.