LXL04_003378 | RubberDandelionOmics

Gene overview

LXL04_003378

Reference: OH-1004 Chr: Chr01 Coordinates: 76930040-76934604 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1413 bp · LXL04_003378|LXL04_003378|OH1004|cDNA

ATGAGCAACAGAGGTAATAGTAGTGGAAGTGGTAGCAACAGCAACATCAGTTCTTCCAATCGCCCTGAATGGTTGCAACAGTACGACTTGATTGGTAAAATTGGCGAGGGAACTTACGGTCTTGTGTTTTTGGCGAAGATCAAATCCAATCGGAGCAAGTCAATCGCGATTAAAAAGTTCAAGCAATCCAAAGACGGCGATGGTGTTTCCCCTACGGCAATCCGCGAAATCATGTTGCTTAGGGAGATATCCCATGATAA...

CDS

Download CDS FASTA

1413 bp · LXL04_003378|LXL04_003378|OH1004|CDS

ATGAGCAACAGAGGTAATAGTAGTGGAAGTGGTAGCAACAGCAACATCAGTTCTTCCAATCGCCCTGAATGGTTGCAACAGTACGACTTGATTGGTAAAATTGGCGAGGGAACTTACGGTCTTGTGTTTTTGGCGAAGATCAAATCCAATCGGAGCAAGTCAATCGCGATTAAAAAGTTCAAGCAATCCAAAGACGGCGATGGTGTTTCCCCTACGGCAATCCGCGAAATCATGTTGCTTAGGGAGATATCCCATGATAA...

Protein

Download Protein FASTA

470 aa · LXL04_003378|LXL04_003378|OH1004|PROTEIN

MSNRGNSSGSGSNSNISSSNRPEWLQQYDLIGKIGEGTYGLVFLAKIKSNRSKSIAIKKFKQSKDGDGVSPTAIREIMLLREISHDNVVKLVNVHINHIDMSLYLAFDYAEHDLYEIIRHHRDKVNQAINQYTVKSILWQLLNGLNYLHSNWIMHRDLKPSNILVMGDGEEQGVVKIADFGLARIYQAPLKPLFDNGVVVTIWYRAPELLLGGKHYTSAVDMWAVGCIFAELLTLKPLFQGQEVKATPNPFQLDQLDKIF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003378`
TK1151 ID	TkA01G366450
OH-1004 ID	LXL04_003378
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 91.057 / OH-1004 71.489 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003378

Location Chr01:76930040-76934604 (+)

Description Similar to CDKE-1: Cyclin-dependent kinase E-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63610`	Involved in cell differentiation.	HUA ENHANCER3 reveals a role for a cyclin-dependent protein kinase in the specification of floral organ identity in Arabidopsis.2004 · DOI: 10.1242/dev.01187

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0580300`	Cyclin-dependent kinase E-1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003378 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000082 G1/S transition of mitotic cell cycle Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0010344 seed oilbody biogenesis Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0034472 snRNA 3'-end processing Biological Process

GO:0050821 protein stabilization Biological Process

GO:0051301 cell division Biological Process

GO:0000307 cyclin-dependent protein kinase holoenzyme complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016592 mediator complex Cellular Component

KEGG gene cross-reference

aag:5574480

ath:AT5G63610

ddi:DDB_G0267442

dme:Dmel_CG10572

dosa:Os10g0580300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.840

Rank 1 · LXL04_003378 · OH-1004

Cytoplasm0.327

Rank 2 · LXL04_003378 · OH-1004

Cell membrane0.025

Rank 3 · LXL04_003378 · OH-1004

Mitochondrion0.024

Rank 4 · LXL04_003378 · OH-1004

Endoplasmic reticulum0.015

Rank 5 · LXL04_003378 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase28-336 aa

PF07714.24PK_Tyr_Ser-Thr31-235 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003378	`PF00069.32`	Pkinase	28	336	1.3e-67	228.7
LXL04_003378	`PF07714.24`	PK_Tyr_Ser-Thr	31	235	4.2e-32	112.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84TI6`	Arabidopsis thaliana	Cyclin-dependent kinase E-1	78.603%	Swiss-Prot	strong database homology
`Q336M2`	Oryza sativa subsp. japonica	Cyclin-dependent kinase E-1	76.160%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card