TkA01G323240 | RubberDandelionOmics

Gene overview

TkA01G323240

Reference: TK1151 Chr: Chr01 Coordinates: 80448786-80453171 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1774 bp · TkA01G323240|TK1151|cDNA

CTTCGCACCACCCACCTGGCGGCCAAAATTCAGAAAATGCCAAGTCCAAACAATTTCTCACGCGACTATGTTCCTCCCACGCAGTCACCCATGTGGCCTGAAAACCTCTGCGTTTTGGCTAATCGAGTACACCTCTTTGCTTTCTCCACCTTCACCAAACTCTATGTTTTAAGCAACAAAATTCGAGAGATTTCGTAACAAATCTACAGATGGTGGAGTTGGTTTTAGAGGATAAAGATGCCGCCGATTGGGTTTACAGA...

CDS

Download CDS FASTA

1386 bp · TkA01G323240|TK1151|CDS

ATGGTGGAGTTGGTTTTAGAGGATAAAGATGCCGCCGATTGGGTTTACAGAGGAGAAGGAGGCCTCAATATTGTTCTTGCATACAACGGATCCTCTTCCAACTTCATTGGCAAAGTGTTACGGGTACGAAAGGTAAAGAGGAATGGAACGGAATGTGAGAAAGCTCCCTCAGCTTTATCTGTGCATGAGTGTCTTGTATGGGAAGGCGTAGGAGATCTTTTATCTGCTTCAACAAAAGATATTGTAAATCATATGTATGC...

Protein

Download Protein FASTA

461 aa · TkA01G323240|TK1151|PROTEIN

MVELVLEDKDAADWVYRGEGGLNIVLAYNGSSSNFIGKVLRVRKVKRNGTECEKAPSALSVHECLVWEGVGDLLSASTKDIVNHMYAKHVMSPLLGPQHVDAGVRVQVTKEFLELVHNRVLFQRPSWRVDNARVNTLHDSALLMSDHSIFPHAVDGEECCISVEIKPKCGFLPVSKFIREKNSAKKRISRFKLHQILKFHQGKISQISEYDPLDLFSGSKPRVLKSIKDLFLTPQNNFRVLINGSLVFGSSGGEAEDTDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G323240`
TK1151 ID	TkA01G323240
OH-1004 ID	LXL04_003673
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 92.262 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G323240

Location Chr01:80448786-80453171 (-)

Description Similar to IPK1: Inositol-pentakisphosphate 2-kinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42810`	May phosphorylate Ins(1,3,4,5,6)P₅ at position 2 to produce phytate, Ins(1,2,3,4,5,6)P₆.	Generation of phytate-free seeds in Arabidopsis through disruption of inositol polyphosphate kinases.2005 · DOI: 10.1073/pnas.0504172102 Characterization of an Arabidopsis inositol 1,3,4,5,6-pentakisphosphate 2-kinase (AtIPK1).2006 · DOI: 10.1042/bj20051331

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8AVX5`	Phosphorylates Ins(1,3,4,5,6)P5 at position 2 to form Ins(1,2,3,4,5,6)P6 (InsP6 or phytate).	No verified direct reference in this release
`Os04g0661200`	Phosphorylates Ins(1,3,4,5,6)P5 at position 2 to form Ins(1,2,3,4,5,6)P6 (InsP6 or phytate).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003673 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007368 determination of left/right symmetry Biological Process

GO:0010264 myo-inositol hexakisphosphate biosynthetic process Biological Process

GO:0030643 intracellular phosphate ion homeostasis Biological Process

GO:0032402 melanosome transport Biological Process

GO:0032958 inositol phosphate biosynthetic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0048527 lateral root development Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051607 defense response to virus Biological Process

GO:0055062 phosphate ion homeostasis Biological Process

GO:0060287 epithelial cilium movement involved in determination of left/right asymmetry Biological Process

GO:1901838 positive regulation of transcription of nucleolar large rRNA by RNA polymerase I Biological Process

KEGG gene cross-reference

ath:AT5G42810

dosa:Os04g0661200

dre:541511

rno:306808

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.571

Rank 1 · TkA01G323240 · TK1151

Nucleus0.366

Rank 2 · TkA01G323240 · TK1151

Cell membrane0.102

Rank 3 · TkA01G323240 · TK1151

Mitochondrion0.077

Rank 4 · TkA01G323240 · TK1151

Endoplasmic reticulum0.075

Rank 5 · TkA01G323240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18358Tudor_42-19 aa

PF06090Ins_P5_2-kin16-424 aa

PF18358Tudor_4435-451 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G323240	`PF18358`	Tudor_4	2	19	0.29	11.5
TkA01G323240	`PF06090`	Ins_P5_2-kin	16	424	3.8e-109	366.2
TkA01G323240	`PF18358`	Tudor_4	435	451	0.29	11.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YN9`	Arabidopsis thaliana	sp\|Q93YN9\|IPPK_ARATH Inositol-pentakisphosphate 2-kinase	52.400%	Swiss-Prot	High
`B8AVX5`	Oryza sativa subsp. indica	sp\|B8AVX5\|IPK1_ORYSI Inositol-pentakisphosphate 2-kinase IPK1	50.900%	Swiss-Prot	High
`Q7XQZ6`	Oryza sativa subsp. japonica	sp\|Q7XQZ6\|IPK1_ORYSJ Inositol-pentakisphosphate 2-kinase IPK1	50.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card