TkA01G319790 | RubberDandelionOmics

Gene overview

TkA01G319790

Reference: TK1151 Chr: Chr01 Coordinates: 79402728-79406248 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1576 bp · TkA01G319790|TK1151|cDNA

AAAAATGTACTTCAATCAATCCTTTCTCTCCGATTTCATCTCCTTGACTCTGCTTCTCCTCTTTCATCAATCTCTATGATCGTACCCTCAAATTCCCCCCCATTCCTGTCATTAAAACCCTCTAATTTTCCCCCATTTTTCGTTATTAAAACCCGCCGATTCTTCAACGATGATGATGCTGGTGAACTGCTCAAATTGCCATACGGCGTTGCAGCTTCCGCCGGGAGCCACATCGATAAGATGTGCAATATGTCAAGCCA...

CDS

Download CDS FASTA

1122 bp · TkA01G319790|TK1151|CDS

ATGATGATGCTGGTGAACTGCTCAAATTGCCATACGGCGTTGCAGCTTCCGCCGGGAGCCACATCGATAAGATGTGCAATATGTCAAGCCATCACCAACCTTGGCGACCCCCGTACCGCCGCTCCACGGCCTCATACCGGTGGTCATCCAGCACCTGCTCCATCCTCTTATGGTCCTCCTCAACCATCGCCTTACAACCACGCTCCACCTGGTCCACCGCCATCTGCTCATGGCAGGAAGAAGGCGGTGATTGTAGGCAT...

Protein

Download Protein FASTA

373 aa · TkA01G319790|TK1151|PROTEIN

MMMLVNCSNCHTALQLPPGATSIRCAICQAITNLGDPRTAAPRPHTGGHPAPAPSSYGPPQPSPYNHAPPGPPPSAHGRKKAVIVGISYKFSSHELKGCINDANCMKYLLINKFRYPESSIIMLTEEQTDPYKIPTKQNMRMALFWLVQGCQPGDSLVFHYSGHGSRQRNYNGDEVDGYDETLCPLDFETQGMIVDDEVNAAIVKPLPHGVKLHAIIDACHSGTVLDLPFLCRMNRSGQYVWEDHRPRSGIWKGSNGGEV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G319790`
TK1151 ID	TkA01G319790
OH-1004 ID	LXL04_033563
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G319790

Location Chr01:79402728-79406248 (-)

Description Similar to AMC1: Metacaspase-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02170`	Cysteine protease that cleaves specifically after arginine or lysine residues.	Two Arabidopsis metacaspases AtMCP1b and AtMCP2b are arginine/lysine-specific cysteine proteases and activate apoptosis-like cell death in yeast.2005 · DOI: 10.1074/jbc.m413527200
`At4g25110`	Acts as a negative regulator of oxidative stress cell death and hypersensitive cell death response mediated by immune response.	No verified direct reference in this release
`At5g64240`	Metacaspase-3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033563 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process

GO:0006952 defense response Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0043069 negative regulation of programmed cell death Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004197 cysteine-type endopeptidase activity Molecular Function

GO:0004198 calcium-dependent cysteine-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ago:AGOS_ADL266C

ath:AT1G02170

ath:AT4G25110

ath:AT5G64240

pgu:PGUG_00072

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.558

Rank 1 · TkA01G319790 · TK1151

Nucleus0.458

Rank 2 · TkA01G319790 · TK1151

Cell membrane0.166

Rank 3 · TkA01G319790 · TK1151

Endoplasmic reticulum0.057

Rank 4 · TkA01G319790 · TK1151

Lysosome / Vacuole0.042

Rank 5 · TkA01G319790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13717Zn_ribbon_43-30 aa

PF22910EDR4-like_1st4-31 aa

PF23547Zn_ribbon_FGT1_15-30 aa

PF11331Zn_ribbon_125-21 aa

PF06943zf-LSD17-31 aa

PF00656Peptidase_C1479-338 aa

PF31181Pept_C14_Metacaspase80-229 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G319790	`PF13717`	Zn_ribbon_4	3	30	0.011	16.4
TkA01G319790	`PF22910`	EDR4-like_1st	4	31	0.064	13.5
TkA01G319790	`PF23547`	Zn_ribbon_FGT1_1	5	30	0.0037	17.5
TkA01G319790	`PF11331`	Zn_ribbon_12	5	21	0.55	10.7
TkA01G319790	`PF06943`	zf-LSD1	7	31	4.8e-11	43.1
TkA01G319790	`PF00656`	Peptidase_C14	79	338	8.8e-37	127.7
TkA01G319790	`PF31181`	Pept_C14_Metacaspase	80	229	1.4e-58	198.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XJE6`	Arabidopsis thaliana	sp\|Q7XJE6\|MCA1_ARATH Metacaspase-1	73.700%	Swiss-Prot	High
`Q7XJE5`	Arabidopsis thaliana	sp\|Q7XJE5\|MCA2_ARATH Metacaspase-2	53.900%	Swiss-Prot	High
`Q9FMG1`	Arabidopsis thaliana	sp\|Q9FMG1\|MCA3_ARATH Metacaspase-3	50.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card