LXL04_033563 | RubberDandelionOmics

Gene overview

LXL04_033563

Reference: OH-1004 Chr: Chr07 Coordinates: 47657067-47660600 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1122 bp · LXL04_033563|LXL04_033563|OH1004|cDNA

ATGATGATGCTGGTGAACTGCTCAAATTGCCATACGGCGTTGCAGCTTCCGCCGGGAGCCACATCGATAAGATGTGCAATATGTCAAGCCATCACCAACCTTGGCGACCCCCGTACCGCCGCTCCACGGCCTCATACCGGTGGTCATCCAGCACCTGCTCCATCCTCTTATGGTCCTCCTCAACCATCGCCTTACAACCACGCTCCACCTGGTCCACCGCCATCTGCTCATGGCAGGAAGAAGGCGGTGATTGTAGGCAT...

CDS

Download CDS FASTA

1122 bp · LXL04_033563|LXL04_033563|OH1004|CDS

ATGATGATGCTGGTGAACTGCTCAAATTGCCATACGGCGTTGCAGCTTCCGCCGGGAGCCACATCGATAAGATGTGCAATATGTCAAGCCATCACCAACCTTGGCGACCCCCGTACCGCCGCTCCACGGCCTCATACCGGTGGTCATCCAGCACCTGCTCCATCCTCTTATGGTCCTCCTCAACCATCGCCTTACAACCACGCTCCACCTGGTCCACCGCCATCTGCTCATGGCAGGAAGAAGGCGGTGATTGTAGGCAT...

Protein

Download Protein FASTA

373 aa · LXL04_033563|LXL04_033563|OH1004|PROTEIN

MMMLVNCSNCHTALQLPPGATSIRCAICQAITNLGDPRTAAPRPHTGGHPAPAPSSYGPPQPSPYNHAPPGPPPSAHGRKKAVIVGISYKFSSHELKGCINDANCMKYLLINKFRYPESSIIMLTEEQTDPYKIPTKQNMRMALFWLVQGCQPGDSLVFHYSGHGSRQRNYNGDEVDGYDETLCPLDFETQGMIVDDEVNAAIVKPLPHGVKLHAIIDACHSGTVLDLPFLCRMNRSGQYVWEDHRPRSGIWKGSNGGEV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033563`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033563

Location Chr07:47657067-47660600 (-)

Description Similar to AMC1: Metacaspase-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02170`	Cysteine protease that cleaves specifically after arginine or lysine residues.	Two Arabidopsis metacaspases AtMCP1b and AtMCP2b are arginine/lysine-specific cysteine proteases and activate apoptosis-like cell death in yeast.2005 · DOI: 10.1074/jbc.m413527200
`At4g25110`	Acts as a negative regulator of oxidative stress cell death and hypersensitive cell death response mediated by immune response.	No verified direct reference in this release
`At5g64240`	Metacaspase-3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033563 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process

GO:0006952 defense response Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0043069 negative regulation of programmed cell death Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004197 cysteine-type endopeptidase activity Molecular Function

GO:0004198 calcium-dependent cysteine-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ago:AGOS_ADL266C

ath:AT1G02170

ath:AT4G25110

ath:AT5G64240

pgu:PGUG_00072

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.558

Rank 1 · LXL04_033563 · OH-1004

Nucleus0.458

Rank 2 · LXL04_033563 · OH-1004

Cell membrane0.166

Rank 3 · LXL04_033563 · OH-1004

Endoplasmic reticulum0.057

Rank 4 · LXL04_033563 · OH-1004

Lysosome / Vacuole0.042

Rank 5 · LXL04_033563 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06943.18zf-LSD17-31 aa

PF00656.28Peptidase_C1479-338 aa

PF31181.1Pept_C14_Metacaspase80-229 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033563	`PF06943.18`	zf-LSD1	7	31	4.8e-11	43.1
LXL04_033563	`PF00656.28`	Peptidase_C14	79	338	8.8e-37	127.7
LXL04_033563	`PF31181.1`	Pept_C14_Metacaspase	80	229	1.4e-58	198.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XJE6`	Arabidopsis thaliana	Metacaspase-1	74.462%	Swiss-Prot	strong database homology
`Q7XJE5`	Arabidopsis thaliana	Metacaspase-2	54.067%	Swiss-Prot	strong database homology
`Q9FMG1`	Arabidopsis thaliana	Metacaspase-3	50.168%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card