TkA01G009140 | RubberDandelionOmics

Gene overview

TkA01G009140

Reference: TK1151 Chr: Chr01 Coordinates: 2464985-2469948 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4444 bp · TkA01G009140|TK1151|cDNA

ATTTTGAACGCTGACTTGTTACCACCACGCACATCACACACACAATTTGCCATAAAATTGACAAAGTCTGATTTGGAACACGGTTTTGCCCCCAATTTGCCATTGACAAATACCAATAGTTGAACTCCGGTCTCTACAGGGATCTGTCGGCGAAATTCAGTCCACACGTTAACCTCGTTTGCAACACCGCCACCATAAAAGCATGATGCTAATGCTACACGAGGACTGAGGACTGAGGAGCTGCTCGATTCCATCTGATA...

CDS

Download CDS FASTA

2466 bp · TkA01G009140|TK1151|CDS

ATGAAAGCGGTTCATGATTTCTTTGCTGATAAATTTTATGAAAAATGGCCCACACGTCCTAAACTCATTAACCCCCTCTTCAAGAAGCTAAACGACAACCAAAGGGAATCATTACACACGCCATTCACAATGGATGAAATGAAACAAGCGGTGTGGAATTGCGGTGGAGATAAAGCACCGGGACCAGACGGATACACTTTCAAAATCCTAAAAAACAAGTGGGAAATCATAAAACAAGATATATTTCGTGCGGTTAAGCA...

Protein

Download Protein FASTA

821 aa · TkA01G009140|TK1151|PROTEIN

MKAVHDFFADKFYEKWPTRPKLINPLFKKLNDNQRESLHTPFTMDEMKQAVWNCGGDKAPGPDGYTFKILKNKWEIIKQDIFRAVKHFETRGSIAKGCNSSFITLIPKVKDPLDLGDYRPINLIGCVYKVIAKILATRLKLVVGHVIDEVQSAYIKNRNILDGPLVINEICSWAKTAKEKIFMLKIDFEKAFDSVNWSYLDSIMEQMGFSSQWRKWIYGCLSSSKASILVNGVPTQEFSITKGVRQGDPLSSFLFILAME...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G009140`
TK1151 ID	TkA01G009140
OH-1004 ID	LXL04_014455
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	48.200
Protein coverage (%)	TK1151 99.026 / OH-1004 40.528 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G009140

Location Chr01:2464985-2469948 (-)

Description Similar to Os01g0810000: Probable U3 small nucleolar RNA-associated protein 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55630`	Voltage-independent, large conductance and potassium- selective tonoplast ion channel.	TPK1 is a vacuolar ion channel different from the slow-vacuolar cation channel.2005 · DOI: 10.1104/pp.105.065599 TPK1, a Ca(2+)-regulated Arabidopsis vacuole two-pore K(+) channel is activated by 14-3-3 proteins.2007 · DOI: 10.1111/j.1365-313x.2007.03255.x
`At1g02510`	Voltage-independent, instantaneously activating, potassium-selective plasma membrane ion channel.	No verified direct reference in this release
`At4g01840`	Probable voltage-independent potassium-selective tonoplast ion channel.	No verified direct reference in this release
`UniProt: P92555`	Uncharacterized mitochondrial protein AtMg01250.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0752300`	Highly selective inward-rectifying potassium channel that is specifically located in the tonoplast of large vacuoles.	Rice two-pore K+ channels are expressed in different types of vacuoles.2011 · DOI: 10.1105/tpc.110.081463
`Os07g0108800`	Highly selective inward-rectifying potassium channel that is specifically located in the tonoplast of protein storage vacuoles.	Rice two-pore K+ channels are expressed in different types of vacuoles.2011 · DOI: 10.1105/tpc.110.081463

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014455 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006364 rRNA processing Biological Process

GO:0009561 megagametogenesis Biological Process

GO:0032197 retrotransposition Biological Process

GO:0090304 nucleic acid metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0032040 small-subunit processome Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003824 catalytic activity Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0009036 type II site-specific deoxyribonuclease activity Molecular Function

KEGG gene cross-reference

ath:AT3G60360

dosa:Os01g0810000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.663

Rank 1 · TkA01G009140 · TK1151

Nucleus0.276

Rank 2 · TkA01G009140 · TK1151

Cell membrane0.136

Rank 3 · TkA01G009140 · TK1151

Lysosome / Vacuole0.030

Rank 4 · TkA01G009140 · TK1151

Mitochondrion0.029

Rank 5 · TkA01G009140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04574DUF592104-153 aa

PF00078RVT_1107-364 aa

PF13966zf-RVT537-584 aa

PF13966zf-RVT636-718 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G009140	`PF04574`	DUF592	104	153	0.17	12.4
TkA01G009140	`PF00078`	RVT_1	107	364	7.5e-33	114.8
TkA01G009140	`PF13966`	zf-RVT	537	584	1.3e-15	58.6
TkA01G009140	`PF13966`	zf-RVT	636	718	1.3e-15	58.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LBL1`	Arabidopsis thaliana	sp\|Q8LBL1\|KCO1_ARATH Two-pore potassium channel 1	60.800%	Swiss-Prot	High
`Q9FWX6`	Arabidopsis thaliana	sp\|Q9FWX6\|KCO4_ARATH Two-pore potassium channel 4	32.700%	Swiss-Prot	Medium
`Q9S6Z8`	Arabidopsis thaliana	sp\|Q9S6Z8\|KCO5_ARATH Two-pore potassium channel 5	34.200%	Swiss-Prot	Medium
`P92555`	Arabidopsis thaliana	sp\|P92555\|M1250_ARATH Uncharacterized mitochondrial protein AtMg01250	38.400%	Swiss-Prot	Low
`Q850M0`	Oryza sativa subsp. japonica	sp\|Q850M0\|KCO1_ORYSJ Two pore potassium channel a	54.200%	Swiss-Prot	High
`Q8LIN5`	Oryza sativa subsp. japonica	sp\|Q8LIN5\|KCO2_ORYSJ Two pore potassium channel b	52.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card