LXL04_037757 | RubberDandelionOmics

Gene overview

LXL04_037757

Reference: OH-1004 Chr: Chr09 Coordinates: 20309789-20312100 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

537 bp · LXL04_037757|LXL04_037757|OH1004|cDNA

ATGGAATTGTCGAATCCAAACCCTTTCGATGGAATTGGCGAATTTGTCGATGGTGCGCCGGTGAAGGATGGAATTGTCGAATCTGTCGATGGTGCGCCGGTGAAGGATATCGCTCCTAGCTGGGAAGAGGTACCGGGTTTAATACTCACGTGGGGTCAGAGGTCAGGAGTTCGATCCCTACAAAATCCAATTTGGGTGCCTCTTAAACTTGTGTCACATGTGGGGAAATTTTCCCTAGAAACCCTTATGGGGGCTGGGTT...

CDS

Download CDS FASTA

537 bp · LXL04_037757|LXL04_037757|OH1004|CDS

ATGGAATTGTCGAATCCAAACCCTTTCGATGGAATTGGCGAATTTGTCGATGGTGCGCCGGTGAAGGATGGAATTGTCGAATCTGTCGATGGTGCGCCGGTGAAGGATATCGCTCCTAGCTGGGAAGAGGTACCGGGTTTAATACTCACGTGGGGTCAGAGGTCAGGAGTTCGATCCCTACAAAATCCAATTTGGGTGCCTCTTAAACTTGTGTCACATGTGGGGAAATTTTCCCTAGAAACCCTTATGGGGGCTGGGTT...

Protein

Download Protein FASTA

178 aa · LXL04_037757|LXL04_037757|OH1004|PROTEIN

MELSNPNPFDGIGEFVDGAPVKDGIVESVDGAPVKDIAPSWEEVPGLILTWGQRSGVRSLQNPIWVPLKLVSHVGKFSLETLMGAGFARFAELELEVLVEILRYTTQSRGWRDREAVRRKETKEFIVEVFDGDTKTNEGHVADVPCLTIAIKKKLEDLITRHYLERDKQDPDLIRYLA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037757`
TK1151 ID	TkA02G552790
OH-1004 ID	LXL04_037757
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	92.200
Protein coverage (%)	TK1151 58.716 / OH-1004 35.955 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037757

Location Chr09:20309789-20312100 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02570`	Involved in ubiquitination and subsequent proteasomal degradation of target proteins.	Null mutation of AtCUL1 causes arrest in early embryogenesis in Arabidopsis.2002 · DOI: 10.1091/mbc.e02-02-0077 Arabidopsis CAND1, an unmodified CUL1-interacting protein, is involved in multiple developmental pathways controlled by ubiquitin/proteasome-mediated protein Degradation.2004 · DOI: 10.1105/tpc.021949

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037757 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010265 SCF complex assembly Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0048366 leaf development Biological Process

KEGG gene cross-reference

ath:AT4G02570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.440

Rank 1 · LXL04_037757 · OH-1004

Nucleus0.334

Rank 2 · LXL04_037757 · OH-1004

Mitochondrion0.119

Rank 3 · LXL04_037757 · OH-1004

Cell membrane0.098

Rank 4 · LXL04_037757 · OH-1004

Plastid0.080

Rank 5 · LXL04_037757 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AH6`	Arabidopsis thaliana	Cullin-1	72.414%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card