TkA02G552790 | RubberDandelionOmics

Gene overview

TkA02G552790

Reference: TK1151 Chr: Chr02 Coordinates: 142640473-142640802 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

330 bp · TkA02G552790|TK1151|cDNA

AGCTGGAAAGAGGTACCGGGTTTAATACACACGTGGGGTCAGAGGTCGGGAGTTCAATCCCTACAAAACTCAATTTGGGTGCCTCTTAAACTTGTGTCACACGTGGGGAAATTTTCCCTGGAAACCCTTATGGGGGCTGGGTTTGCCCGCTTTGCGGAGCTCGAACTCGGGGTGCTCGTTGAAATATTGCGAGTAAAATGTACAACGACCTTAATAACTAATATTGAAAATTGCAAATGCCAACCAGAACTACGAAGTGC...

CDS

Download CDS FASTA

330 bp · TkA02G552790|TK1151|CDS

AGCTGGAAAGAGGTACCGGGTTTAATACACACGTGGGGTCAGAGGTCGGGAGTTCAATCCCTACAAAACTCAATTTGGGTGCCTCTTAAACTTGTGTCACACGTGGGGAAATTTTCCCTGGAAACCCTTATGGGGGCTGGGTTTGCCCGCTTTGCGGAGCTCGAACTCGGGGTGCTCGTTGAAATATTGCGAGTAAAATGTACAACGACCTTAATAACTAATATTGAAAATTGCAAATGCCAACCAGAACTACGAAGTGC...

Protein

Download Protein FASTA

109 aa · TkA02G552790|TK1151|PROTEIN

SWKEVPGLIHTWGQRSGVQSLQNSIWVPLKLVSHVGKFSLETLMGAGFARFAELELGVLVEILRVKCTTTLITNIENCKCQPELRSASYIETQLELYCNCKCQPIMIKN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G552790`
TK1151 ID	TkA02G552790
OH-1004 ID	LXL04_037757
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	92.200
Protein coverage (%)	TK1151 58.716 / OH-1004 35.955 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G552790`
Location	Chr02:142640473-142640802 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037757` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009733 response to auxin Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0009867 jasmonic acid mediated signaling pathway Biological Process GO:0009873 ethylene-activated signaling pathway Biological Process GO:0010087 phloem or xylem histogenesis Biological Process GO:0010265 SCF complex assembly Biological Process GO:0016567 protein ubiquitination Biological Process GO:0042752 regulation of circadian rhythm Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0048366 leaf development Biological Process
KEGG gene cross-reference	ath:AT4G02570 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.470

Rank 1 · TkA02G552790 · TK1151

Nucleus0.349

Rank 2 · TkA02G552790 · TK1151

Mitochondrion0.176

Rank 3 · TkA02G552790 · TK1151

Cell membrane0.099

Rank 4 · TkA02G552790 · TK1151

Endoplasmic reticulum0.072

Rank 5 · TkA02G552790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15137ECPIP64-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G552790	`PF15137`	ECPIP	64	103	0.05	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card