RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_035430
Reference: OH-1004 Chr: Chr08 Coordinates: 22420821-22423401 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1467 bp · LXL04_035430|LXL04_035430|OH1004|cDNA

ATGGAAAAAGTTGCAGAATTTGAAGCTACAATGGGAGGCCCAAAAACCCAACCGATTCAGCGCATCTCTGTTCTCTCGTATCCTTTGGGCGGCAAGGTTATGGATGCAGGATCTGTAAGTTCTTCAGCTACCAAGTCACAATCACGATGCCCCCTTCAGGAACAATTCCTTCAAAGAAAGAACTCTCGAGAAAACTTGGACAGATTCATACCAAATAGATCAGCGATGGATTTCGATTATGCTCATTACATGCTAACGGA...

CDS

Download CDS FASTA

1467 bp · LXL04_035430|LXL04_035430|OH1004|CDS

ATGGAAAAAGTTGCAGAATTTGAAGCTACAATGGGAGGCCCAAAAACCCAACCGATTCAGCGCATCTCTGTTCTCTCGTATCCTTTGGGCGGCAAGGTTATGGATGCAGGATCTGTAAGTTCTTCAGCTACCAAGTCACAATCACGATGCCCCCTTCAGGAACAATTCCTTCAAAGAAAGAACTCTCGAGAAAACTTGGACAGATTCATACCAAATAGATCAGCGATGGATTTCGATTATGCTCATTACATGCTAACGGA...

Protein

Download Protein FASTA

488 aa · LXL04_035430|LXL04_035430|OH1004|PROTEIN

MEKVAEFEATMGGPKTQPIQRISVLSYPLGGKVMDAGSVSSSATKSQSRCPLQEQFLQRKNSRENLDRFIPNRSAMDFDYAHYMLTEAKKGKENPMGISPSKEAYRKHLAESFNMNRTRILAFKNKPPTPMDAIPNDCSTSVNHSKPAKARRYIPQTSERTLDAPDLVDDYYLNLLDWGSSNVLAIALGSTVYLWDATDGNTSELVTVEEEAGPVTSVKWAPDGRHISVGLNNSDVQLWDSTSNRLLRTLKGCHQSRVGA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_035430
TK1151 IDTkA04G131270
OH-1004 IDLXL04_035430
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)99.600
Protein coverage (%)TK1151 100.000 / OH-1004 93.238
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_035430
LocationChr08:22420821-22423401 (-)
DescriptionSimilar to CDC20-1: Cell division cycle 20.1, cofactor of APC complex
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g33270 Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. No verified direct reference in this release
At4g33260 Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. No verified direct reference in this release
At5g27570 Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. No verified direct reference in this release
At5g27080 Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. No verified direct reference in this release
At5g26900 Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_035430 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0016567 protein ubiquitination Biological Process
GO:0031145 anaphase-promoting complex-dependent catabolic process Biological Process
GO:0051301 cell division Biological Process
GO:1905786 positive regulation of anaphase-promoting complex-dependent catabolic process Biological Process
GO:0005634 nucleus Cellular Component
GO:0005680 anaphase-promoting complex Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0033597 mitotic checkpoint complex Cellular Component
GO:0080008 Cul4-RING E3 ubiquitin ligase complex Cellular Component
GO:0010997 anaphase-promoting complex binding Molecular Function
GO:0019900 kinase binding Molecular Function
GO:1990757 ubiquitin ligase activator activity Molecular Function
KEGG gene cross-reference
ath:AT4G33260
ath:AT4G33270
ath:AT5G26900
ath:AT5G27080
ath:AT5G27570
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.572
Rank 1 · LXL04_035430 · OH-1004
Cytoplasm0.389
Rank 2 · LXL04_035430 · OH-1004
Cell membrane0.058
Rank 3 · LXL04_035430 · OH-1004
Mitochondrion0.041
Rank 4 · LXL04_035430 · OH-1004
Golgi apparatus0.037
Rank 5 · LXL04_035430 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24807.2WD40_CDC20-Fz162-461 aa
PF24817.2WD40_WDHD1_1st172-265 aa
PF23389.2Beta-prop_WDR19_1st176-277 aa
PF25047.1Beta-prop_TEP1_2nd181-325 aa
PF25171.2Beta-prop_WDR36-Utp21_1st182-263 aa
PF25391.2WD40_Gbeta183-329 aa
PF25168.2Beta-prop_WDR36-Utp21_2nd183-319 aa
PF23609.2Beta-prop_EIPR1183-376 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_035430PF24807.2WD40_CDC20-Fz1624611e-124416.3
LXL04_035430PF24817.2WD40_WDHD1_1st1722659.4e-2381.5
LXL04_035430PF23389.2Beta-prop_WDR19_1st1762773.1e-1246.9
LXL04_035430PF25047.1Beta-prop_TEP1_2nd1813251e-1661.6
LXL04_035430PF25171.2Beta-prop_WDR36-Utp21_1st1822631.3e-1248.5
LXL04_035430PF25391.2WD40_Gbeta1833298e-1452.1
LXL04_035430PF25168.2Beta-prop_WDR36-Utp21_2nd1833195.2e-1349.7
LXL04_035430PF23609.2Beta-prop_EIPR11833766.3e-0833.1
LXL04_035430PF25173.2Beta-prop_WDR3_1st1842842.3e-37129.2
LXL04_035430PF24814.2WD40_Prp191852621.5e-30107.0
LXL04_035430PF25174.2Beta-prop_THOC31863292.3e-45155.4
LXL04_035430PF25175.2Beta-prop_WDR51872565.4e-33115.2
LXL04_035430PF23414.2Beta-prop_EML_21893367.1e-2175.5
LXL04_035430PF23383.2Beta-prop_IFT140_1st1892791.1e-1144.8
LXL04_035430PF24796.2WDR551912913.1e-1660.0
LXL04_035430PF23409.2Beta-prop_EML2042842.1e-1557.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SZA4Arabidopsis thalianaCell division cycle 20.1, cofactor of APC complex78.431%Swiss-Protstrong database homology
Q9S7I8Arabidopsis thalianaCell division cycle 20.2, cofactor of APC complex79.279%Swiss-Protstrong database homology
Q3E906Arabidopsis thalianaCell division cycle 20.5, cofactor of APC complex67.904%Swiss-Protstrong database homology
Q9S7H3Arabidopsis thalianaCell division cycle 20.3, cofactor of APC complex67.347%Swiss-Protstrong database homology
Q4PSE4Arabidopsis thalianaCell division cycle 20.4, cofactor of APC complex66.667%Swiss-Protstrong database homology

JBrowse

View in Genome Browser