TkA04G131270 | RubberDandelionOmics

Gene overview

TkA04G131270

Reference: TK1151 Chr: Chr04 Coordinates: 34225641-34228179 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2175 bp · TkA04G131270|TK1151|cDNA

CTAAAACCCAACCGATTCAGCGCATCGCTATTCTCTCGTATCCTTTGGGCGGCAAGGGTATATCGGTAAAACAATTTGCAACGGATACATTGTAAACTTAGTAGCCGTTAGGTGTAGCCGCAGCGAACCACCAGAAAACGCATCACGAACCCTAGTTTTTCGTTTATATATAAATCCCTAAATTCTCTCTTAGCTTAATCACACAAGCATTAATCGATCTCTCCTTCTCTCTTCTCTATCTCTTGCTCTAGCAACCGCCT...

CDS

Download CDS FASTA

1368 bp · TkA04G131270|TK1151|CDS

ATGGATGCAGGATCTGTAAGTTCTTCAGCTACCAAGTCACAATCACGATGCCCCCTTCAGGAACAATTCCTTCAAAGAAAGAACTCTCGAGAAAACTTGGACAGATTCATACCAAATAGATCAGCGATGGATTTCGATTATGCTCATTACATGCTAACGGAAGCGAAAAAAGGTAAGGAAAATCCAATGGGCAGCTCACCTTCTAAGGAAGCATACAGGAAGCATTTGGCAGAGAGCTTTAACATGAACAGAACGAGAAT...

Protein

Download Protein FASTA

455 aa · TkA04G131270|TK1151|PROTEIN

MDAGSVSSSATKSQSRCPLQEQFLQRKNSRENLDRFIPNRSAMDFDYAHYMLTEAKKGKENPMGSSPSKEAYRKHLAESFNMNRTRILAFKNKPPTPMDAIPNDSSTSVNHSKPAKARRYIPQTSERTLDAPDLVDDYYLNLLDWGSSNVLAIALGSTVYLWDATDGNTSELVTVEEEAGPVTSVKWAPDGRHISVGLNNSDVQLWDSTSNRLLRTLKGCHQSRVGALDWNNHILTTGGMDGRIVNNDVRVRSHIIETYN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G131270`
TK1151 ID	TkA04G131270
OH-1004 ID	LXL04_035430
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 93.238 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G131270

Location Chr04:34225641-34228179 (+)

Description Similar to CDC20-1: Cell division cycle 20.1, cofactor of APC complex

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33270`	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	No verified direct reference in this release
`At4g33260`	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	No verified direct reference in this release
`At5g27570`	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	No verified direct reference in this release
`At5g26900`	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	No verified direct reference in this release
`At5g27080`	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035430 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0031145 anaphase-promoting complex-dependent catabolic process Biological Process

GO:0051301 cell division Biological Process

GO:1905786 positive regulation of anaphase-promoting complex-dependent catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005680 anaphase-promoting complex Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0033597 mitotic checkpoint complex Cellular Component

GO:0080008 Cul4-RING E3 ubiquitin ligase complex Cellular Component

GO:0010997 anaphase-promoting complex binding Molecular Function

GO:0019900 kinase binding Molecular Function

GO:1990757 ubiquitin ligase activator activity Molecular Function

KEGG gene cross-reference

ath:AT4G33260

ath:AT4G33270

ath:AT5G26900

ath:AT5G27080

ath:AT5G27570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.612

Rank 1 · TkA04G131270 · TK1151

Cytoplasm0.362

Rank 2 · TkA04G131270 · TK1151

Cell membrane0.055

Rank 3 · TkA04G131270 · TK1151

Lysosome / Vacuole0.038

Rank 4 · TkA04G131270 · TK1151

Mitochondrion0.037

Rank 5 · TkA04G131270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16529Ge1_WD40119-206 aa

PF23184WD40_CFAP43126-208 aa

PF24807WD40_CDC20-Fz129-428 aa

PF24817WD40_WDHD1_1st139-232 aa

PF29037DSE1_N141-168 aa

PF23389Beta-prop_WDR19_1st143-244 aa

PF25460Beta-prop_Aladin147-231 aa

PF24506KNTC1_N147-216 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G131270	`PF16529`	Ge1_WD40	119	206	0.00016	21.5
TkA04G131270	`PF23184`	WD40_CFAP43	126	208	0.23	11.2
TkA04G131270	`PF24807`	WD40_CDC20-Fz	129	428	8.5e-125	416.6
TkA04G131270	`PF24817`	WD40_WDHD1_1st	139	232	6.4e-23	82.1
TkA04G131270	`PF29037`	DSE1_N	141	168	8.6e-13	48.8
TkA04G131270	`PF23389`	Beta-prop_WDR19_1st	143	244	2.5e-12	47.2
TkA04G131270	`PF25460`	Beta-prop_Aladin	147	231	2.2e-11	44.2
TkA04G131270	`PF24506`	KNTC1_N	147	216	0.28	11.1
TkA04G131270	`PF25047`	Beta-prop_TEP1_2nd	148	269	8.6e-17	61.9
TkA04G131270	`PF24105`	Beta-prop_CAF1B_HIR1	149	216	2.9e-14	53.6
TkA04G131270	`PF25171`	Beta-prop_WDR36-Utp21_1st	149	230	9.2e-13	48.9
TkA04G131270	`PF23393`	Beta-prop_WDR90_POC16_2nd	149	197	2.1e-07	31.2
TkA04G131270	`PF25172`	Beta-prop_WDR3_2nd	150	242	4e-19	69.7
TkA04G131270	`PF25391`	WD40_Gbeta	150	296	1.1e-13	51.7
TkA04G131270	`PF25168`	Beta-prop_WDR36-Utp21_2nd	150	286	3.8e-13	50.1
TkA04G131270	`PF23609`	Beta-prop_EIPR1	150	343	8.1e-08	32.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZA4`	Arabidopsis thaliana	sp\|Q9SZA4\|CDC21_ARATH Cell division cycle 20.1, cofactor of APC complex	78.600%	Swiss-Prot	High
`Q9S7I8`	Arabidopsis thaliana	sp\|Q9S7I8\|CDC22_ARATH Cell division cycle 20.2, cofactor of APC complex	79.900%	Swiss-Prot	High
`Q3E906`	Arabidopsis thaliana	sp\|Q3E906\|CD205_ARATH Cell division cycle 20.5, cofactor of APC complex	69.200%	Swiss-Prot	High
`Q4PSE4`	Arabidopsis thaliana	sp\|Q4PSE4\|CDC24_ARATH Cell division cycle 20.4, cofactor of APC complex	68.300%	Swiss-Prot	High
`Q9S7H3`	Arabidopsis thaliana	sp\|Q9S7H3\|CD203_ARATH Cell division cycle 20.3, cofactor of APC complex	67.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card